Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5710
Gene name
LocationContig_54:21201..23463
Strand-
Gene length (bp)2262
Transcript length (bp)2262
Coding sequence length (bp)2262
Protein length (aa) 754

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08632 Zds_C Activator of mitotic machinery Cdc14 phosphatase activation C-term 2.1E-27 561 611

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14100|ZDS1_SCHPO Protein zds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zds1 PE=1 SV=2 6 225 2.0E-16
sp|O14100|ZDS1_SCHPO Protein zds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zds1 PE=1 SV=2 561 645 3.0E-15
sp|P50111|ZDS1_YEAST Protein ZDS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZDS1 PE=1 SV=1 569 610 8.0E-09
sp|P54786|ZDS2_YEAST Protein ZDS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZDS2 PE=1 SV=1 569 610 1.0E-07

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2544
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5710 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|869
Ophiocordyceps camponoti-floridani Ophcf2|01373
Ophiocordyceps camponoti-rufipedis Ophun1|2608
Ophiocordyceps kimflemingae Ophio5|5486
Ophiocordyceps subramaniannii Hirsu2|3762

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5710
MDNPSDIAQELSNLQALRRLSMDVGNSIDPDMPPGLTAMPVIAPTGDDDENDPSRLLWVPARVHPELAPSEFKSF
LENRVQAIRRRSGDLSFSVDGDSSSPALSLRRKKSMLSRQIDNTGGRGAVGYVDGAERLHRLRSNGSQNSPELSI
EDLVKDPTKAVQKLTQDSHDAATASRGSENFEDDMPILPMAPGMGLRRSTRTTYRKGGSLRSGDRGSLSRRLGHR
QPENDLSDIASKSDSMHKVHSENTVDKHSRPERVIRRASDHSQESHSASEGLSEEPANRDQQPTRKPSVTRQASQ
DRADRLENTNSRMFPTRSSSQNAGSLRDHVPDQAMDDSSTLKPVRRSATHSNFTIKQPQYTSKSSQHQIQMHGRG
DALASPSAISCGDASRTDNLTFIPTLNHAEKSKSEKKSRKDRDDDSASTSSGKSGGAWKWLKGVADDREKKREEK
REESRRSKGKAAAEKTPHDNVRLDLIQTSIERDNFKGRESLVLDRDDVDHKLLEERKKESNRKSDSKKDKDGSLI
SSIFGVSKKRDKEKSNKKSPHHLQVPEEVPYKPQRPDVDYEWTRFPLLKERMIYRMAHLKLANPRRSLLSQVLLS
NFMYSYLAIVQAMHPQMNVPTSPQQKRLEEEARRKRQEQEYLAQQQMQDGQDDEDGLDQYNFEYHRVRAVLNIVD
WKMVLMVAKAAVQYAESGPDEQVEYVDDAQIYEDEHGSDNADDYGYEASEEYGHESKDYPEYPGGADGQDRHGRD
SMW*
Coding >OphauG2|5710
ATGGACAATCCTAGCGATATCGCTCAAGAGTTGAGCAACTTGCAAGCCCTCAGAAGGCTCTCCATGGATGTTGGC
AACAGCATAGATCCAGACATGCCGCCAGGCCTTACCGCAATGCCCGTCATAGCCCCCACTGGAGACGACGATGAA
AATGATCCATCCCGTCTCCTCTGGGTTCCCGCTAGGGTTCATCCAGAGCTCGCCCCGAGTGAATTCAAATCCTTT
TTGGAAAATCGTGTTCAAGCCATCAGACGGAGATCTGGCGACTTGTCATTTTCTGTTGACGGTGACTCCAGCAGT
CCGGCTTTATCTCTTCGCCGTAAAAAGTCAATGTTATCTAGACAAATCGACAATACTGGCGGCAGAGGCGCTGTG
GGCTACGTCGACGGAGCTGAGCGCCTACATAGGTTGCGGTCCAATGGGAGCCAAAACAGTCCTGAACTCAGCATC
GAAGATCTGGTCAAAGATCCCACCAAAGCGGTGCAAAAGCTCACCCAGGACTCGCACGACGCTGCCACAGCCTCG
CGCGGTTCTGAAAACTTCGAAGACGACATGCCCATTCTACCCATGGCTCCTGGTATGGGTTTACGTAGATCTACC
CGCACTACGTATCGCAAGGGCGGCAGCTTGCGCTCTGGAGATAGGGGCTCGCTTTCTCGACGATTGGGCCATAGG
CAGCCAGAGAATGACTTGTCCGACATTGCTTCCAAAAGCGACTCGATGCACAAGGTGCACTCGGAGAATACTGTC
GATAAGCATTCGCGTCCGGAACGGGTCATTCGAAGGGCAAGTGATCACTCACAAGAATCACATAGCGCCTCTGAA
GGTCTCTCAGAAGAACCCGCGAATCGTGATCAACAGCCAACACGCAAACCATCGGTAACAAGGCAAGCTTCTCAA
GACCGCGCAGATCGACTAGAAAATACGAACAGCAGGATGTTTCCAACAAGATCTTCATCACAAAATGCCGGATCT
CTCAGAGACCATGTTCCAGACCAGGCCATGGATGACTCCTCTACCTTGAAGCCAGTGCGGCGCTCGGCCACACAT
AGCAATTTTACAATCAAGCAGCCCCAATATACCTCCAAGTCATCACAACACCAGATCCAGATGCACGGTAGGGGA
GATGCATTAGCCTCTCCCTCTGCTATCTCGTGCGGAGACGCCTCTCGCACCGACAATTTGACCTTTATTCCAACG
TTAAACCACGCAGAAAAGTCCAAATCGGAAAAGAAGTCGAGGAAAGATCGAGACGACGATTCTGCCAGCACATCA
AGTGGCAAGTCGGGCGGTGCATGGAAATGGCTCAAGGGCGTGGCTGATGACAGAGAGAAGAAGAGGGAAGAGAAG
AGAGAAGAGAGCAGACGCTCCAAGGGCAAGGCTGCCGCGGAAAAGACCCCGCATGACAATGTCCGGCTGGACCTT
ATCCAAACATCAATCGAGAGGGATAATTTCAAGGGCCGCGAGAGTCTCGTATTGGACCGCGACGATGTCGATCAC
AAACTTCTGGAAGAACGTAAAAAGGAGAGCAATCGAAAAAGCGACTCTAAAAAGGACAAAGACGGCAGTCTTATC
TCCTCCATTTTTGGTGTCAGCAAGAAGAGGGATAAGGAAAAGTCAAACAAGAAGAGCCCACACCATCTGCAGGTC
CCCGAAGAAGTGCCCTACAAGCCTCAGCGGCCAGATGTAGACTACGAATGGACGCGGTTCCCGCTTCTCAAAGAG
AGAATGATCTATCGCATGGCACATCTCAAGCTGGCCAATCCACGGCGCTCCCTCCTCAGTCAAGTGCTATTGAGC
AATTTCATGTACAGCTACTTGGCCATTGTGCAGGCTATGCACCCGCAGATGAACGTGCCAACGTCGCCGCAGCAA
AAACGGCTTGAGGAGGAGGCACGGCGCAAGCGGCAGGAACAAGAATACCTTGCTCAACAGCAGATGCAGGACGGT
CAAGATGACGAAGACGGTCTTGACCAGTACAACTTTGAATATCACCGAGTAAGAGCTGTCTTGAATATTGTTGAC
TGGAAAATGGTGCTAATGGTGGCCAAGGCTGCTGTTCAGTATGCGGAGTCTGGTCCTGACGAGCAGGTTGAATAT
GTCGACGATGCACAAATTTACGAGGACGAACACGGGAGCGACAACGCAGATGACTATGGCTATGAAGCCTCTGAA
GAATATGGCCATGAATCCAAAGACTACCCTGAATACCCCGGTGGCGCTGACGGCCAAGACCGCCACGGTCGAGAT
AGCATGTGGTGA
Transcript >OphauG2|5710
ATGGACAATCCTAGCGATATCGCTCAAGAGTTGAGCAACTTGCAAGCCCTCAGAAGGCTCTCCATGGATGTTGGC
AACAGCATAGATCCAGACATGCCGCCAGGCCTTACCGCAATGCCCGTCATAGCCCCCACTGGAGACGACGATGAA
AATGATCCATCCCGTCTCCTCTGGGTTCCCGCTAGGGTTCATCCAGAGCTCGCCCCGAGTGAATTCAAATCCTTT
TTGGAAAATCGTGTTCAAGCCATCAGACGGAGATCTGGCGACTTGTCATTTTCTGTTGACGGTGACTCCAGCAGT
CCGGCTTTATCTCTTCGCCGTAAAAAGTCAATGTTATCTAGACAAATCGACAATACTGGCGGCAGAGGCGCTGTG
GGCTACGTCGACGGAGCTGAGCGCCTACATAGGTTGCGGTCCAATGGGAGCCAAAACAGTCCTGAACTCAGCATC
GAAGATCTGGTCAAAGATCCCACCAAAGCGGTGCAAAAGCTCACCCAGGACTCGCACGACGCTGCCACAGCCTCG
CGCGGTTCTGAAAACTTCGAAGACGACATGCCCATTCTACCCATGGCTCCTGGTATGGGTTTACGTAGATCTACC
CGCACTACGTATCGCAAGGGCGGCAGCTTGCGCTCTGGAGATAGGGGCTCGCTTTCTCGACGATTGGGCCATAGG
CAGCCAGAGAATGACTTGTCCGACATTGCTTCCAAAAGCGACTCGATGCACAAGGTGCACTCGGAGAATACTGTC
GATAAGCATTCGCGTCCGGAACGGGTCATTCGAAGGGCAAGTGATCACTCACAAGAATCACATAGCGCCTCTGAA
GGTCTCTCAGAAGAACCCGCGAATCGTGATCAACAGCCAACACGCAAACCATCGGTAACAAGGCAAGCTTCTCAA
GACCGCGCAGATCGACTAGAAAATACGAACAGCAGGATGTTTCCAACAAGATCTTCATCACAAAATGCCGGATCT
CTCAGAGACCATGTTCCAGACCAGGCCATGGATGACTCCTCTACCTTGAAGCCAGTGCGGCGCTCGGCCACACAT
AGCAATTTTACAATCAAGCAGCCCCAATATACCTCCAAGTCATCACAACACCAGATCCAGATGCACGGTAGGGGA
GATGCATTAGCCTCTCCCTCTGCTATCTCGTGCGGAGACGCCTCTCGCACCGACAATTTGACCTTTATTCCAACG
TTAAACCACGCAGAAAAGTCCAAATCGGAAAAGAAGTCGAGGAAAGATCGAGACGACGATTCTGCCAGCACATCA
AGTGGCAAGTCGGGCGGTGCATGGAAATGGCTCAAGGGCGTGGCTGATGACAGAGAGAAGAAGAGGGAAGAGAAG
AGAGAAGAGAGCAGACGCTCCAAGGGCAAGGCTGCCGCGGAAAAGACCCCGCATGACAATGTCCGGCTGGACCTT
ATCCAAACATCAATCGAGAGGGATAATTTCAAGGGCCGCGAGAGTCTCGTATTGGACCGCGACGATGTCGATCAC
AAACTTCTGGAAGAACGTAAAAAGGAGAGCAATCGAAAAAGCGACTCTAAAAAGGACAAAGACGGCAGTCTTATC
TCCTCCATTTTTGGTGTCAGCAAGAAGAGGGATAAGGAAAAGTCAAACAAGAAGAGCCCACACCATCTGCAGGTC
CCCGAAGAAGTGCCCTACAAGCCTCAGCGGCCAGATGTAGACTACGAATGGACGCGGTTCCCGCTTCTCAAAGAG
AGAATGATCTATCGCATGGCACATCTCAAGCTGGCCAATCCACGGCGCTCCCTCCTCAGTCAAGTGCTATTGAGC
AATTTCATGTACAGCTACTTGGCCATTGTGCAGGCTATGCACCCGCAGATGAACGTGCCAACGTCGCCGCAGCAA
AAACGGCTTGAGGAGGAGGCACGGCGCAAGCGGCAGGAACAAGAATACCTTGCTCAACAGCAGATGCAGGACGGT
CAAGATGACGAAGACGGTCTTGACCAGTACAACTTTGAATATCACCGAGTAAGAGCTGTCTTGAATATTGTTGAC
TGGAAAATGGTGCTAATGGTGGCCAAGGCTGCTGTTCAGTATGCGGAGTCTGGTCCTGACGAGCAGGTTGAATAT
GTCGACGATGCACAAATTTACGAGGACGAACACGGGAGCGACAACGCAGATGACTATGGCTATGAAGCCTCTGAA
GAATATGGCCATGAATCCAAAGACTACCCTGAATACCCCGGTGGCGCTGACGGCCAAGACCGCCACGGTCGAGAT
AGCATGTGGTGA
Gene >OphauG2|5710
ATGGACAATCCTAGCGATATCGCTCAAGAGTTGAGCAACTTGCAAGCCCTCAGAAGGCTCTCCATGGATGTTGGC
AACAGCATAGATCCAGACATGCCGCCAGGCCTTACCGCAATGCCCGTCATAGCCCCCACTGGAGACGACGATGAA
AATGATCCATCCCGTCTCCTCTGGGTTCCCGCTAGGGTTCATCCAGAGCTCGCCCCGAGTGAATTCAAATCCTTT
TTGGAAAATCGTGTTCAAGCCATCAGACGGAGATCTGGCGACTTGTCATTTTCTGTTGACGGTGACTCCAGCAGT
CCGGCTTTATCTCTTCGCCGTAAAAAGTCAATGTTATCTAGACAAATCGACAATACTGGCGGCAGAGGCGCTGTG
GGCTACGTCGACGGAGCTGAGCGCCTACATAGGTTGCGGTCCAATGGGAGCCAAAACAGTCCTGAACTCAGCATC
GAAGATCTGGTCAAAGATCCCACCAAAGCGGTGCAAAAGCTCACCCAGGACTCGCACGACGCTGCCACAGCCTCG
CGCGGTTCTGAAAACTTCGAAGACGACATGCCCATTCTACCCATGGCTCCTGGTATGGGTTTACGTAGATCTACC
CGCACTACGTATCGCAAGGGCGGCAGCTTGCGCTCTGGAGATAGGGGCTCGCTTTCTCGACGATTGGGCCATAGG
CAGCCAGAGAATGACTTGTCCGACATTGCTTCCAAAAGCGACTCGATGCACAAGGTGCACTCGGAGAATACTGTC
GATAAGCATTCGCGTCCGGAACGGGTCATTCGAAGGGCAAGTGATCACTCACAAGAATCACATAGCGCCTCTGAA
GGTCTCTCAGAAGAACCCGCGAATCGTGATCAACAGCCAACACGCAAACCATCGGTAACAAGGCAAGCTTCTCAA
GACCGCGCAGATCGACTAGAAAATACGAACAGCAGGATGTTTCCAACAAGATCTTCATCACAAAATGCCGGATCT
CTCAGAGACCATGTTCCAGACCAGGCCATGGATGACTCCTCTACCTTGAAGCCAGTGCGGCGCTCGGCCACACAT
AGCAATTTTACAATCAAGCAGCCCCAATATACCTCCAAGTCATCACAACACCAGATCCAGATGCACGGTAGGGGA
GATGCATTAGCCTCTCCCTCTGCTATCTCGTGCGGAGACGCCTCTCGCACCGACAATTTGACCTTTATTCCAACG
TTAAACCACGCAGAAAAGTCCAAATCGGAAAAGAAGTCGAGGAAAGATCGAGACGACGATTCTGCCAGCACATCA
AGTGGCAAGTCGGGCGGTGCATGGAAATGGCTCAAGGGCGTGGCTGATGACAGAGAGAAGAAGAGGGAAGAGAAG
AGAGAAGAGAGCAGACGCTCCAAGGGCAAGGCTGCCGCGGAAAAGACCCCGCATGACAATGTCCGGCTGGACCTT
ATCCAAACATCAATCGAGAGGGATAATTTCAAGGGCCGCGAGAGTCTCGTATTGGACCGCGACGATGTCGATCAC
AAACTTCTGGAAGAACGTAAAAAGGAGAGCAATCGAAAAAGCGACTCTAAAAAGGACAAAGACGGCAGTCTTATC
TCCTCCATTTTTGGTGTCAGCAAGAAGAGGGATAAGGAAAAGTCAAACAAGAAGAGCCCACACCATCTGCAGGTC
CCCGAAGAAGTGCCCTACAAGCCTCAGCGGCCAGATGTAGACTACGAATGGACGCGGTTCCCGCTTCTCAAAGAG
AGAATGATCTATCGCATGGCACATCTCAAGCTGGCCAATCCACGGCGCTCCCTCCTCAGTCAAGTGCTATTGAGC
AATTTCATGTACAGCTACTTGGCCATTGTGCAGGCTATGCACCCGCAGATGAACGTGCCAACGTCGCCGCAGCAA
AAACGGCTTGAGGAGGAGGCACGGCGCAAGCGGCAGGAACAAGAATACCTTGCTCAACAGCAGATGCAGGACGGT
CAAGATGACGAAGACGGTCTTGACCAGTACAACTTTGAATATCACCGAGTAAGAGCTGTCTTGAATATTGTTGAC
TGGAAAATGGTGCTAATGGTGGCCAAGGCTGCTGTTCAGTATGCGGAGTCTGGTCCTGACGAGCAGGTTGAATAT
GTCGACGATGCACAAATTTACGAGGACGAACACGGGAGCGACAACGCAGATGACTATGGCTATGAAGCCTCTGAA
GAATATGGCCATGAATCCAAAGACTACCCTGAATACCCCGGTGGCGCTGACGGCCAAGACCGCCACGGTCGAGAT
AGCATGTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail