Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5701
Gene name
LocationContig_539:10784..11702
Strand+
Gene length (bp)918
Transcript length (bp)918
Coding sequence length (bp)918
Protein length (aa) 306

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 3.3E-12 33 112
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 5.3E-12 31 293
PF12146 Hydrolase_4 Serine aminopeptidase, S33 7.1E-09 35 270
PF08386 Abhydrolase_4 TAP-like protein 1.6E-04 223 285

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A8IAD8|RUTD_AZOC5 Putative aminoacrylate hydrolase RutD OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rutD PE=3 SV=1 36 155 2.0E-08
sp|P9WNH1|BPOC_MYCTU Putative non-heme bromoperoxidase BpoC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=bpoC PE=1 SV=1 36 118 1.0E-06
sp|P9WNH0|BPOC_MYCTO Putative non-heme bromoperoxidase BpoC OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=bpoC PE=3 SV=1 36 118 1.0E-06
sp|B7KWT4|RUTD_METC4 Putative aminoacrylate hydrolase RutD OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rutD PE=3 SV=1 34 155 5.0E-06
sp|C7CM33|RUTD_METED Putative aminoacrylate hydrolase RutD OS=Methylobacterium extorquens (strain DSM 5838 / DM4) GN=rutD PE=3 SV=1 34 155 6.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3036
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5701 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7861
Ophiocordyceps camponoti-floridani Ophcf2|02361
Ophiocordyceps camponoti-rufipedis Ophun1|695
Ophiocordyceps kimflemingae Ophio5|4152
Ophiocordyceps subramaniannii Hirsu2|5247

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5701
MGFLGIMTTWQRQTCFFGHDQGEARDDGAKARRDTYSVLIFDNRGVGISGRPLMRYSTSEMARDTLELVNAIGWT
GPRQLHLIGISLGGMIAQELACVAPQRLASLNLICTSARLPRGPSVLVSFAKRVAFAMLPLPQEDALRRVAVSVF
PMEWLLAPDEDDLPSPASTPGCDPPGSLAPGQDSCAEYGHFDSNFQRFQAQTLTNRLNPAFAPPRIMCQGIAAGW
HCKTDEQLRAMADAVGRERILVLHGTLDAMIGVEHGRRLIDVLKPADGLIVEGLGHGPIMQRPKWFNQVLERKIS
LCSRL*
Coding >OphauG2|5701
ATGGGCTTTCTTGGTATCATGACGACATGGCAGCGGCAGACTTGCTTCTTCGGACACGACCAGGGCGAGGCGCGA
GACGACGGGGCCAAGGCTAGACGAGACACCTATTCTGTCCTCATATTTGACAATCGCGGCGTGGGCATCAGCGGC
CGCCCGCTGATGCGCTACTCGACGAGCGAAATGGCGCGCGACACTCTGGAGCTGGTCAATGCTATTGGCTGGACT
GGCCCTCGTCAGCTGCACCTCATCGGCATCTCGCTAGGCGGCATGATTGCCCAGGAGCTTGCCTGTGTCGCGCCT
CAGCGCCTGGCATCGCTGAACCTCATATGTACTTCGGCGCGTTTGCCGCGAGGGCCTTCGGTTCTGGTCTCTTTT
GCGAAGCGCGTGGCCTTTGCCATGCTGCCTCTACCCCAAGAAGACGCCTTGCGAAGAGTAGCAGTCTCAGTCTTC
CCCATGGAGTGGCTTCTTGCGCCCGACGAGGACGACTTGCCCTCGCCTGCCTCGACGCCTGGCTGTGATCCACCT
GGCTCTCTTGCACCTGGCCAAGACTCGTGCGCAGAGTACGGCCACTTTGACTCCAACTTTCAGCGATTTCAAGCC
CAGACGCTGACGAATCGCCTCAATCCTGCGTTTGCGCCCCCCCGAATAATGTGCCAAGGCATCGCTGCTGGCTGG
CACTGCAAGACGGACGAGCAGCTGCGTGCCATGGCCGATGCTGTTGGGCGAGAGCGCATCCTGGTGCTGCATGGC
ACTCTTGACGCCATGATTGGCGTTGAGCATGGACGGAGGCTCATTGATGTCTTGAAGCCGGCCGACGGGCTCATT
GTCGAAGGATTAGGCCACGGACCCATTATGCAGCGCCCCAAGTGGTTTAACCAAGTCCTTGAGCGGAAAATATCC
CTCTGCTCACGTCTTTGA
Transcript >OphauG2|5701
ATGGGCTTTCTTGGTATCATGACGACATGGCAGCGGCAGACTTGCTTCTTCGGACACGACCAGGGCGAGGCGCGA
GACGACGGGGCCAAGGCTAGACGAGACACCTATTCTGTCCTCATATTTGACAATCGCGGCGTGGGCATCAGCGGC
CGCCCGCTGATGCGCTACTCGACGAGCGAAATGGCGCGCGACACTCTGGAGCTGGTCAATGCTATTGGCTGGACT
GGCCCTCGTCAGCTGCACCTCATCGGCATCTCGCTAGGCGGCATGATTGCCCAGGAGCTTGCCTGTGTCGCGCCT
CAGCGCCTGGCATCGCTGAACCTCATATGTACTTCGGCGCGTTTGCCGCGAGGGCCTTCGGTTCTGGTCTCTTTT
GCGAAGCGCGTGGCCTTTGCCATGCTGCCTCTACCCCAAGAAGACGCCTTGCGAAGAGTAGCAGTCTCAGTCTTC
CCCATGGAGTGGCTTCTTGCGCCCGACGAGGACGACTTGCCCTCGCCTGCCTCGACGCCTGGCTGTGATCCACCT
GGCTCTCTTGCACCTGGCCAAGACTCGTGCGCAGAGTACGGCCACTTTGACTCCAACTTTCAGCGATTTCAAGCC
CAGACGCTGACGAATCGCCTCAATCCTGCGTTTGCGCCCCCCCGAATAATGTGCCAAGGCATCGCTGCTGGCTGG
CACTGCAAGACGGACGAGCAGCTGCGTGCCATGGCCGATGCTGTTGGGCGAGAGCGCATCCTGGTGCTGCATGGC
ACTCTTGACGCCATGATTGGCGTTGAGCATGGACGGAGGCTCATTGATGTCTTGAAGCCGGCCGACGGGCTCATT
GTCGAAGGATTAGGCCACGGACCCATTATGCAGCGCCCCAAGTGGTTTAACCAAGTCCTTGAGCGGAAAATATCC
CTCTGCTCACGTCTTTGA
Gene >OphauG2|5701
ATGGGCTTTCTTGGTATCATGACGACATGGCAGCGGCAGACTTGCTTCTTCGGACACGACCAGGGCGAGGCGCGA
GACGACGGGGCCAAGGCTAGACGAGACACCTATTCTGTCCTCATATTTGACAATCGCGGCGTGGGCATCAGCGGC
CGCCCGCTGATGCGCTACTCGACGAGCGAAATGGCGCGCGACACTCTGGAGCTGGTCAATGCTATTGGCTGGACT
GGCCCTCGTCAGCTGCACCTCATCGGCATCTCGCTAGGCGGCATGATTGCCCAGGAGCTTGCCTGTGTCGCGCCT
CAGCGCCTGGCATCGCTGAACCTCATATGTACTTCGGCGCGTTTGCCGCGAGGGCCTTCGGTTCTGGTCTCTTTT
GCGAAGCGCGTGGCCTTTGCCATGCTGCCTCTACCCCAAGAAGACGCCTTGCGAAGAGTAGCAGTCTCAGTCTTC
CCCATGGAGTGGCTTCTTGCGCCCGACGAGGACGACTTGCCCTCGCCTGCCTCGACGCCTGGCTGTGATCCACCT
GGCTCTCTTGCACCTGGCCAAGACTCGTGCGCAGAGTACGGCCACTTTGACTCCAACTTTCAGCGATTTCAAGCC
CAGACGCTGACGAATCGCCTCAATCCTGCGTTTGCGCCCCCCCGAATAATGTGCCAAGGCATCGCTGCTGGCTGG
CACTGCAAGACGGACGAGCAGCTGCGTGCCATGGCCGATGCTGTTGGGCGAGAGCGCATCCTGGTGCTGCATGGC
ACTCTTGACGCCATGATTGGCGTTGAGCATGGACGGAGGCTCATTGATGTCTTGAAGCCGGCCGACGGGCTCATT
GTCGAAGGATTAGGCCACGGACCCATTATGCAGCGCCCCAAGTGGTTTAACCAAGTCCTTGAGCGGAAAATATCC
CTCTGCTCACGTCTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail