Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5691
Gene name
LocationContig_537:9556..10617
Strand+
Gene length (bp)1061
Transcript length (bp)969
Coding sequence length (bp)969
Protein length (aa) 323

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10230 LIDHydrolase Lipid-droplet associated hydrolase 1.2E-44 17 294

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5HZX7|LDAH_RAT Lipid droplet-associated hydrolase OS=Rattus norvegicus GN=Ldah PE=2 SV=1 19 311 3.0E-09
sp|Q06522|YP147_YEAST Uncharacterized protein YPR147C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR147C PE=1 SV=1 8 293 2.0E-08

GO

GO Term Description Terminal node
GO:0016298 lipase activity Yes
GO:0005811 lipid droplet Yes
GO:0019915 lipid storage Yes
GO:0043228 non-membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0043229 intracellular organelle No
GO:0016787 hydrolase activity No
GO:0051179 localization No
GO:0043226 organelle No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003824 catalytic activity No
GO:0051235 maintenance of location No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7230
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5691 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6245

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5691
MLSSISLPSAPCQGAQRVLLYLVCGNPGCIGFYGDFTETLRAMLDGHDSKQAIAWDIYGRSLLGFGQVEQCEQPP
QDLDAQIDAIYSDVVARRDGNGQPYDWAVLMGHSIGAYICLAIMERHARAATRKTDAQDLVLRHGLLLFPTIALL
AESRSGRYLALARRLKLSPGLAQAVANAATWLLPRPLVLWVLTAALGMSERVAGVAAQWLASHDGVRQTIHLAGS
ELDNVGQDSWDSAEELWSLAPESKAPTVFMLYAKTDHWVADSVRDECVAKRKDCARIYIDKGELSHAFCTTERNS
WLVAKIVDGWIAEIESGLNQGQ*
Coding >OphauG2|5691
ATGCTCTCGTCAATATCGCTGCCGTCAGCACCGTGCCAGGGTGCTCAACGGGTCCTACTCTATCTCGTATGCGGC
AACCCGGGTTGCATCGGCTTCTACGGCGATTTTACTGAGACACTGCGGGCCATGCTCGACGGCCACGACAGCAAG
CAAGCAATCGCGTGGGACATTTATGGGCGAAGTCTATTAGGGTTTGGCCAAGTCGAACAGTGCGAGCAGCCGCCG
CAGGACCTGGATGCCCAGATTGATGCGATTTACAGCGACGTGGTGGCGAGAAGAGACGGCAATGGCCAGCCGTAC
GACTGGGCAGTGCTCATGGGGCACTCGATTGGCGCGTACATCTGTCTCGCCATCATGGAGCGCCATGCACGTGCG
GCGACACGCAAGACTGACGCCCAAGACTTGGTGCTACGCCACGGACTGCTGCTCTTCCCGACAATTGCCCTGCTG
GCCGAGTCACGGAGCGGACGGTATTTGGCGCTCGCCCGCCGCCTGAAGCTCTCGCCAGGACTAGCCCAGGCCGTT
GCCAACGCAGCAACCTGGCTGCTGCCGCGCCCGCTGGTGCTCTGGGTGCTGACGGCGGCGCTGGGCATGTCGGAG
CGCGTAGCCGGCGTGGCGGCCCAGTGGCTTGCAAGCCACGACGGGGTGCGGCAGACGATTCACCTGGCCGGATCC
GAGCTGGACAATGTCGGGCAGGATAGCTGGGACTCGGCCGAGGAGCTATGGAGCTTGGCGCCAGAGTCCAAGGCG
CCAACAGTGTTTATGCTTTACGCAAAGACGGATCATTGGGTTGCTGATAGTGTTAGAGATGAATGCGTCGCCAAG
CGGAAAGACTGTGCTAGGATTTATATTGATAAAGGAGAGCTGTCGCATGCCTTTTGTACCACGGAGCGAAACAGC
TGGCTTGTTGCCAAGATTGTGGACGGGTGGATCGCAGAGATTGAAAGTGGGCTCAACCAAGGGCAATGA
Transcript >OphauG2|5691
ATGCTCTCGTCAATATCGCTGCCGTCAGCACCGTGCCAGGGTGCTCAACGGGTCCTACTCTATCTCGTATGCGGC
AACCCGGGTTGCATCGGCTTCTACGGCGATTTTACTGAGACACTGCGGGCCATGCTCGACGGCCACGACAGCAAG
CAAGCAATCGCGTGGGACATTTATGGGCGAAGTCTATTAGGGTTTGGCCAAGTCGAACAGTGCGAGCAGCCGCCG
CAGGACCTGGATGCCCAGATTGATGCGATTTACAGCGACGTGGTGGCGAGAAGAGACGGCAATGGCCAGCCGTAC
GACTGGGCAGTGCTCATGGGGCACTCGATTGGCGCGTACATCTGTCTCGCCATCATGGAGCGCCATGCACGTGCG
GCGACACGCAAGACTGACGCCCAAGACTTGGTGCTACGCCACGGACTGCTGCTCTTCCCGACAATTGCCCTGCTG
GCCGAGTCACGGAGCGGACGGTATTTGGCGCTCGCCCGCCGCCTGAAGCTCTCGCCAGGACTAGCCCAGGCCGTT
GCCAACGCAGCAACCTGGCTGCTGCCGCGCCCGCTGGTGCTCTGGGTGCTGACGGCGGCGCTGGGCATGTCGGAG
CGCGTAGCCGGCGTGGCGGCCCAGTGGCTTGCAAGCCACGACGGGGTGCGGCAGACGATTCACCTGGCCGGATCC
GAGCTGGACAATGTCGGGCAGGATAGCTGGGACTCGGCCGAGGAGCTATGGAGCTTGGCGCCAGAGTCCAAGGCG
CCAACAGTGTTTATGCTTTACGCAAAGACGGATCATTGGGTTGCTGATAGTGTTAGAGATGAATGCGTCGCCAAG
CGGAAAGACTGTGCTAGGATTTATATTGATAAAGGAGAGCTGTCGCATGCCTTTTGTACCACGGAGCGAAACAGC
TGGCTTGTTGCCAAGATTGTGGACGGGTGGATCGCAGAGATTGAAAGTGGGCTCAACCAAGGGCAATGA
Gene >OphauG2|5691
ATGCTCTCGTCAATATCGCTGCCGTCAGCACCGTGCCAGGGTGCTCAACGGGTCCTACTCTATCTCGTATGCGGC
AACCCGGGTTGCATCGGCTTCTACGGCGATTTTACTGAGACACTGCGGGCCATGCTCGACGGCCACGACAGCAAG
CAAGCAATCGCGTGGGACATTTATGGGCGAAGTCTATTAGGGTTTGGCCAAGTCGAACAGTGCGAGCAGCCGCCG
CAGGACCTGGATGCCCAGATTGATGCGATTTACAGCGACGTGGTGGCGAGAAGAGACGGCAATGGCCAGCCGTAC
GACTGGGCAGTGCTCATGGGGCACTCGATTGGCGCGTACATCTGTCTCGCCATCATGGAGCGCCATGCACGTGCG
GCGACACGCAAGACTGACGCCCAAGACTTGGTGCTACGCCACGGACTGCTGCTCTTCCCGACAATTGCCCTGCTG
GCCGAGTCACGGAGCGGACGGTATTTGGCGCTCGCCCGCCGCCTGAAGCTCTCGCCAGGACTAGCCCAGGCCGTT
GCCAACGCAGCAACCTGGCTGCTGCCGCGCCCGCTGGTGCTCTGGGTGCTGACGGCGGCGCTGGGCATGTCGGAG
CGCGTAGCCGGCGTGGCGGCCCAGTGGCTTGCAAGCCACGACGGGGTGCGGCAGACGATTCACCTGGCCGGATCC
GAGCTGGACAATGTCGGGCAGGATAGCTGGGACTCGGCCGAGGAGCTATGGAGCTTGGCGCCAGAGTCCAAGGCG
CCAACAGTGTTTATGCTTTACGCAAAGACGGATCATTGGGTTGCTGATAGTGTTAGAGATGAATGCGTCGCCAAG
CGGAAAGACTGTGCTAGGATTTATATTGATAAAGGAGAGCTGTCGCATGCCTTTTGTACCACGGAGCGTAAGTCT
ATCTTGAGGAGGCGCGGCTTTTTTTTTTGTTTTTTTTTAAGCTTCGACGCTTTTTCTTCTGGCACAACTAACGAG
CCCTGACAGGAAACAGCTGGCTTGTTGCCAAGATTGTGGACGGGTGGATCGCAGAGATTGAAAGTGGGCTCAACC
AAGGGCAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail