Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5684
Gene name
LocationContig_536:6999..8025
Strand-
Gene length (bp)1026
Transcript length (bp)1026
Coding sequence length (bp)1026
Protein length (aa) 342

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01926 MMR_HSR1 50S ribosome-binding GTPase 2.7E-10 128 211

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B6JW87|MTG1_SCHJY Mitochondrial GTPase 1 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=mtg1 PE=3 SV=1 19 315 6.0E-44
sp|O74776|MTG1_SCHPO Mitochondrial GTPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtg1 PE=3 SV=1 3 312 1.0E-42
sp|A9JTX2|MTG1_XENTR Mitochondrial ribosome-associated GTPase 1 OS=Xenopus tropicalis GN=mtg1 PE=2 SV=1 3 302 3.0E-31
sp|Q03151|MTG1_YEAST Mitochondrial GTPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTG1 PE=1 SV=1 1 292 7.0E-31
sp|Q9BT17|MTG1_HUMAN Mitochondrial ribosome-associated GTPase 1 OS=Homo sapiens GN=MTG1 PE=1 SV=2 20 302 1.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B6JW87|MTG1_SCHJY Mitochondrial GTPase 1 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=mtg1 PE=3 SV=1 19 315 6.0E-44
sp|O74776|MTG1_SCHPO Mitochondrial GTPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtg1 PE=3 SV=1 3 312 1.0E-42
sp|A9JTX2|MTG1_XENTR Mitochondrial ribosome-associated GTPase 1 OS=Xenopus tropicalis GN=mtg1 PE=2 SV=1 3 302 3.0E-31
sp|Q03151|MTG1_YEAST Mitochondrial GTPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTG1 PE=1 SV=1 1 292 7.0E-31
sp|Q9BT17|MTG1_HUMAN Mitochondrial ribosome-associated GTPase 1 OS=Homo sapiens GN=MTG1 PE=1 SV=2 20 302 1.0E-30
sp|E3TDS3|MTG1_ICTPU Mitochondrial ribosome-associated GTPase 1 OS=Ictalurus punctatus GN=mtg1 PE=2 SV=1 2 302 1.0E-29
sp|Q8R2R6|MTG1_MOUSE Mitochondrial ribosome-associated GTPase 1 OS=Mus musculus GN=Mtg1 PE=1 SV=2 20 302 1.0E-29
sp|Q4PS77|MTG1_BOVIN Mitochondrial ribosome-associated GTPase 1 OS=Bos taurus GN=MTG1 PE=2 SV=2 7 302 9.0E-28
sp|Q9VCU5|MTG1_DROME Mitochondrial ribosome-associated GTPase 1 OS=Drosophila melanogaster GN=CG17141 PE=1 SV=2 7 305 9.0E-26
sp|Q17EJ1|MTG1_AEDAE Mitochondrial GTPase 1 OS=Aedes aegypti GN=AAEL003813 PE=3 SV=1 11 303 7.0E-23
sp|Q29AU5|MTG1_DROPS Mitochondrial GTPase 1 OS=Drosophila pseudoobscura pseudoobscura GN=GA14342 PE=3 SV=2 7 303 1.0E-22
sp|B7GGD6|RBGA_ANOFW Ribosome biogenesis GTPase A OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rbgA PE=3 SV=1 14 302 1.0E-22
sp|D5DJL5|RBGA_BACMD Ribosome biogenesis GTPase A OS=Bacillus megaterium (strain DSM 319) GN=rbgA PE=3 SV=1 20 307 3.0E-21
sp|Q8L607|SIN2_ARATH Short integuments 2, mitochondrial OS=Arabidopsis thaliana GN=SIN2 PE=1 SV=1 19 267 3.0E-21
sp|Q819W8|RBGA_BACCR Ribosome biogenesis GTPase A OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rbgA PE=3 SV=1 20 313 6.0E-21
sp|E0TTS5|RBGA_BACPZ Ribosome biogenesis GTPase A OS=Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) GN=rbgA PE=3 SV=1 20 298 4.0E-20
sp|O31743|RBGA_BACSU Ribosome biogenesis GTPase A OS=Bacillus subtilis (strain 168) GN=rbgA PE=1 SV=1 20 298 9.0E-20
sp|C5D8U8|RBGA_GEOSW Ribosome biogenesis GTPase A OS=Geobacillus sp. (strain WCH70) GN=rbgA PE=3 SV=1 20 297 4.0E-19
sp|A8FD69|RBGA_BACP2 Ribosome biogenesis GTPase A OS=Bacillus pumilus (strain SAFR-032) GN=rbgA PE=3 SV=1 20 297 2.0E-18
sp|Q65JP4|RBGA_BACLD Ribosome biogenesis GTPase A OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rbgA PE=3 SV=1 20 297 2.0E-17
sp|Q21086|GNL3_CAEEL Guanine nucleotide-binding protein-like 3 homolog OS=Caenorhabditis elegans GN=nst-1 PE=3 SV=1 22 298 3.0E-15
sp|O82497|DGP2_ARATH DAR GTPase 2, mitochondrial OS=Arabidopsis thaliana GN=DGP2 PE=3 SV=1 24 251 7.0E-14
sp|P40010|NUG1_YEAST Nuclear GTP-binding protein NUG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUG1 PE=1 SV=1 109 296 9.0E-12
sp|Q9WZM6|RBGA_THEMA Ribosome biogenesis GTPase A OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rbgA PE=1 SV=1 19 298 3.0E-11
sp|P75135|RBGA_MYCPN Probable ribosome biogenesis GTPase A OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=rbgA PE=1 SV=1 12 227 3.0E-10
sp|Q6DRP2|GNL3_DANRE Guanine nucleotide-binding protein-like 3 OS=Danio rerio GN=gnl3 PE=2 SV=1 30 298 1.0E-08
sp|Q99LH1|NOG2_MOUSE Nucleolar GTP-binding protein 2 OS=Mus musculus GN=Gnl2 PE=1 SV=2 20 296 1.0E-08
sp|Q13823|NOG2_HUMAN Nucleolar GTP-binding protein 2 OS=Homo sapiens GN=GNL2 PE=1 SV=1 31 296 3.0E-08
sp|Q10LF7|NUG2_ORYSJ Nuclear/nucleolar GTPase 2 OS=Oryza sativa subsp. japonica GN=NUG2 PE=1 SV=1 31 296 5.0E-08
sp|A2XGQ1|NUG2_ORYSI Nuclear/nucleolar GTPase 2 OS=Oryza sativa subsp. indica GN=NUG2 PE=3 SV=1 31 296 5.0E-08
sp|O74791|GRN1_SCHPO GTPase grn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grn1 PE=1 SV=1 109 296 2.0E-07
sp|O14236|NOG2_SCHPO Nucleolar GTP-binding protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nog2 PE=1 SV=1 31 296 2.0E-07
sp|Q9C3Z4|NOG2_PNECA Nucleolar GTP-binding protein 2 OS=Pneumocystis carinii GN=NOG2 PE=2 SV=1 31 296 6.0E-07
sp|Q9C923|NUG2_ARATH Nuclear/nucleolar GTPase 2 OS=Arabidopsis thaliana GN=NUG2 PE=1 SV=1 109 296 8.0E-07
sp|Q49435|RBGA_MYCGE Probable ribosome biogenesis GTPase A OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rbgA PE=3 SV=1 19 297 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0019001 guanyl nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3145
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5684 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1064
Ophiocordyceps camponoti-floridani Ophcf2|03486
Ophiocordyceps camponoti-rufipedis Ophun1|7531
Ophiocordyceps kimflemingae Ophio5|2696
Ophiocordyceps subramaniannii Hirsu2|5529

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5684
MASFVPRPSFVFPSTIPKTYFIGHHATGIQKITQLLPTIGLVVECRDSRLPLSTKNGILDRLVAGRQRLVVYTKS
DLGATTAHVQKHLRDLCRDPVVFWAKNEPQSTRSIIAHFRSFARRQNSILALRVLIIGMPNVGKSSLLNSLRRHG
ASNPRTGLTHKVAPTSNHAGCTRKVGTPVCIVPSHDKGGVAAGVYLLDSPGVFQPFVHDGETMVKIALALGVKNG
LIHDEILADYLLYRLNLWDPSLYHRYCPPTNDIDLVLDCIAKRLGKLKAGGLPNMPEAAAQFLNQWRSGALGHNI
LDDISDAGLRLHEALLNEPPLSLNQARKSHAHQLKLSRMPA*
Coding >OphauG2|5684
ATGGCCTCATTCGTCCCGCGCCCGTCGTTTGTCTTTCCATCAACGATACCCAAGACCTACTTCATCGGCCACCAT
GCCACGGGCATACAAAAAATCACCCAGCTGCTCCCCACCATTGGCCTCGTTGTCGAGTGCCGCGACAGTCGCCTT
CCCCTCTCCACCAAGAACGGCATCCTGGACCGTCTGGTGGCCGGTCGCCAGCGCCTCGTTGTTTACACAAAGTCA
GACCTCGGCGCAACTACTGCCCACGTCCAAAAGCACTTGCGCGACCTGTGCAGGGATCCAGTCGTCTTTTGGGCC
AAGAATGAGCCCCAGAGCACGCGCTCCATAATAGCTCATTTCCGCAGCTTTGCTCGCCGCCAAAACTCCATCCTG
GCCCTGCGCGTCCTCATCATCGGCATGCCCAACGTTGGCAAGAGCTCCTTGCTAAACAGCTTGCGCCGCCATGGC
GCCTCGAATCCGCGAACCGGCTTGACGCACAAGGTGGCGCCAACCAGCAATCACGCTGGCTGCACCCGCAAGGTC
GGCACCCCCGTCTGCATTGTCCCGTCCCATGACAAGGGCGGCGTCGCGGCCGGCGTCTATCTACTCGACTCTCCC
GGCGTCTTCCAGCCCTTTGTCCATGATGGCGAAACAATGGTCAAGATTGCTCTGGCTCTCGGCGTCAAAAATGGC
CTTATCCATGACGAGATTCTCGCAGACTACCTCCTCTATCGCCTCAATCTCTGGGATCCCTCCCTTTATCACCGC
TACTGCCCGCCCACCAACGACATTGACCTCGTCCTTGACTGCATTGCCAAGCGCCTAGGCAAGCTCAAGGCTGGT
GGCCTGCCAAACATGCCCGAAGCCGCAGCCCAATTCCTCAACCAGTGGAGGAGTGGCGCACTTGGCCACAATATC
CTCGACGACATATCCGACGCAGGTTTGAGACTCCACGAGGCGCTGCTTAATGAGCCGCCCCTCAGCCTCAACCAA
GCCAGAAAGTCGCATGCCCACCAGCTAAAGCTGAGCCGCATGCCGGCATAG
Transcript >OphauG2|5684
ATGGCCTCATTCGTCCCGCGCCCGTCGTTTGTCTTTCCATCAACGATACCCAAGACCTACTTCATCGGCCACCAT
GCCACGGGCATACAAAAAATCACCCAGCTGCTCCCCACCATTGGCCTCGTTGTCGAGTGCCGCGACAGTCGCCTT
CCCCTCTCCACCAAGAACGGCATCCTGGACCGTCTGGTGGCCGGTCGCCAGCGCCTCGTTGTTTACACAAAGTCA
GACCTCGGCGCAACTACTGCCCACGTCCAAAAGCACTTGCGCGACCTGTGCAGGGATCCAGTCGTCTTTTGGGCC
AAGAATGAGCCCCAGAGCACGCGCTCCATAATAGCTCATTTCCGCAGCTTTGCTCGCCGCCAAAACTCCATCCTG
GCCCTGCGCGTCCTCATCATCGGCATGCCCAACGTTGGCAAGAGCTCCTTGCTAAACAGCTTGCGCCGCCATGGC
GCCTCGAATCCGCGAACCGGCTTGACGCACAAGGTGGCGCCAACCAGCAATCACGCTGGCTGCACCCGCAAGGTC
GGCACCCCCGTCTGCATTGTCCCGTCCCATGACAAGGGCGGCGTCGCGGCCGGCGTCTATCTACTCGACTCTCCC
GGCGTCTTCCAGCCCTTTGTCCATGATGGCGAAACAATGGTCAAGATTGCTCTGGCTCTCGGCGTCAAAAATGGC
CTTATCCATGACGAGATTCTCGCAGACTACCTCCTCTATCGCCTCAATCTCTGGGATCCCTCCCTTTATCACCGC
TACTGCCCGCCCACCAACGACATTGACCTCGTCCTTGACTGCATTGCCAAGCGCCTAGGCAAGCTCAAGGCTGGT
GGCCTGCCAAACATGCCCGAAGCCGCAGCCCAATTCCTCAACCAGTGGAGGAGTGGCGCACTTGGCCACAATATC
CTCGACGACATATCCGACGCAGGTTTGAGACTCCACGAGGCGCTGCTTAATGAGCCGCCCCTCAGCCTCAACCAA
GCCAGAAAGTCGCATGCCCACCAGCTAAAGCTGAGCCGCATGCCGGCATAG
Gene >OphauG2|5684
ATGGCCTCATTCGTCCCGCGCCCGTCGTTTGTCTTTCCATCAACGATACCCAAGACCTACTTCATCGGCCACCAT
GCCACGGGCATACAAAAAATCACCCAGCTGCTCCCCACCATTGGCCTCGTTGTCGAGTGCCGCGACAGTCGCCTT
CCCCTCTCCACCAAGAACGGCATCCTGGACCGTCTGGTGGCCGGTCGCCAGCGCCTCGTTGTTTACACAAAGTCA
GACCTCGGCGCAACTACTGCCCACGTCCAAAAGCACTTGCGCGACCTGTGCAGGGATCCAGTCGTCTTTTGGGCC
AAGAATGAGCCCCAGAGCACGCGCTCCATAATAGCTCATTTCCGCAGCTTTGCTCGCCGCCAAAACTCCATCCTG
GCCCTGCGCGTCCTCATCATCGGCATGCCCAACGTTGGCAAGAGCTCCTTGCTAAACAGCTTGCGCCGCCATGGC
GCCTCGAATCCGCGAACCGGCTTGACGCACAAGGTGGCGCCAACCAGCAATCACGCTGGCTGCACCCGCAAGGTC
GGCACCCCCGTCTGCATTGTCCCGTCCCATGACAAGGGCGGCGTCGCGGCCGGCGTCTATCTACTCGACTCTCCC
GGCGTCTTCCAGCCCTTTGTCCATGATGGCGAAACAATGGTCAAGATTGCTCTGGCTCTCGGCGTCAAAAATGGC
CTTATCCATGACGAGATTCTCGCAGACTACCTCCTCTATCGCCTCAATCTCTGGGATCCCTCCCTTTATCACCGC
TACTGCCCGCCCACCAACGACATTGACCTCGTCCTTGACTGCATTGCCAAGCGCCTAGGCAAGCTCAAGGCTGGT
GGCCTGCCAAACATGCCCGAAGCCGCAGCCCAATTCCTCAACCAGTGGAGGAGTGGCGCACTTGGCCACAATATC
CTCGACGACATATCCGACGCAGGTTTGAGACTCCACGAGGCGCTGCTTAATGAGCCGCCCCTCAGCCTCAACCAA
GCCAGAAAGTCGCATGCCCACCAGCTAAAGCTGAGCCGCATGCCGGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail