Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5675
Gene name
LocationContig_534:9103..12323
Strand+
Gene length (bp)3220
Transcript length (bp)3168
Coding sequence length (bp)3168
Protein length (aa) 1056

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03941 INCENP_ARK-bind Inner centromere protein, ARK binding region 1.0E-21 948 1003

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q1MTN3|PIC1_SCHPO Inner centromere protein-related protein pic1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pic1 PE=1 SV=2 943 1046 1.0E-14
sp|P38283|SLI15_YEAST Inner centromere protein-related protein SLI15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLI15 PE=1 SV=1 946 1003 1.0E-08

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3929
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5675 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2752
Ophiocordyceps camponoti-floridani Ophcf2|04018
Ophiocordyceps camponoti-rufipedis Ophun1|1976
Ophiocordyceps kimflemingae Ophio5|8569
Ophiocordyceps subramaniannii Hirsu2|7828

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5675
MPSHHVPAEALEEPQNAIFDTLSASEKALETAPLLSGLQQGNTQNDVGSSTSPFAGQSLTRQGIDIPDSDSKPCQ
AMEHQALNDSHSPSDGSSPIRPVVRKSSLNFASLPAREPLTAGKSFGAQVSRTSHIDHTRTSHYNRQTGGKSLGN
VAKSESEDDFETADMRLHHESRGGDSSKTCISHAKTYTQRLQDHISKLGKSDETVATDFESSQPHQSLDQKSLSP
AKKGKLQTTPGAFPNEENEDDCSDWDELPASNNTVAQQTLLLDPSGGTTLDSQNKAIAITHDSVRDGDQVSAGAE
VFPKANKHHKSPSVSTLPALGSITHPDLSTLEKSASASCSDLRLTSAADRVASPSKSSLRDVRESPLRQVKNKLS
SMLKSSRGLLASSAAASAEGKLLLVSPSSAPSGFDSAIAVEPEVPLAAALGPQQNTDEGSPRSVARRRRASTERE
KEEKRREKEAKLILDQNAKLQKAREKEREKAIAFSKEHEQRVTREKYTASEEKKADLPICMETSKVIESNSQKNS
DIVKCDSKEGTNDDIEMQDAPAPSARSVGPCQSTRAAEIKRPVKPAKETQSKTKQAPTLIRVNMGSQQSQYQGAN
RSSFAQETPGYSNSQSQQSLAARTSKASLHGKPAVQSLRGAPPNARTKALDLAARKRDQEEREAQRRRDVKTEMD
RKRAALQEEQRKQDTLQRQTKHGRESATSQTEAKRKAAVEKAKHLRAPPPALRTHANNARSETVLPQDRVYSTAS
SAKGALQNSRPQSRMASNLHRSQDELSRPFNAVLSTTSKTGSKRALGTEDGHVKGQVSRVGPANQSNDAKRRRTS
AGYDDETETETALKIKGPPVRPSGGLKKDLPARPTYGYTSSSHGVQRDLFKATVTAQHHNQTKAAHPLDMAQISK
GPIPFAPTSAGVGASHKTPARSGGLNAAKSTARSSPRFQNGDSIELPEIDTDDEDEDEDDAYGTRVAAWADSPDL
RRALMRQETMDPSKIFGPAAPLNMEEVFSKSKHSFRARTSSANWSGADRLTEEEICRDREARDKLRRDGGWSYEM
SREMI*
Coding >OphauG2|5675
ATGCCATCCCATCATGTACCTGCCGAAGCTCTAGAAGAACCTCAAAATGCTATTTTTGACACCCTGTCTGCCTCA
GAAAAGGCTCTCGAAACAGCACCACTGTTGTCTGGCTTGCAGCAGGGCAATACTCAGAACGATGTCGGAAGCAGC
ACATCACCTTTTGCCGGTCAAAGTCTTACGCGACAAGGAATCGATATCCCAGACTCTGATTCGAAACCGTGCCAA
GCTATGGAACATCAAGCATTAAATGACTCCCATTCGCCATCAGACGGATCCAGCCCCATACGCCCAGTGGTCCGC
AAGAGTAGCTTGAACTTTGCTTCTCTGCCTGCTAGAGAACCACTTACCGCTGGTAAAAGCTTCGGGGCTCAAGTT
TCTCGAACGAGTCATATCGACCACACGCGGACGAGTCACTATAATCGACAAACAGGAGGCAAAAGTCTGGGCAAT
GTCGCAAAATCTGAGAGTGAGGACGATTTCGAGACAGCTGACATGAGACTACATCACGAATCTCGAGGTGGTGAT
AGCAGCAAGACATGTATCAGCCATGCCAAAACCTACACGCAAAGGCTACAAGACCATATTAGTAAACTAGGAAAA
AGCGATGAGACGGTGGCGACAGATTTTGAATCCTCGCAGCCACATCAATCTCTCGATCAGAAATCTCTGTCTCCC
GCAAAGAAAGGCAAATTACAGACAACACCAGGGGCATTTCCGAATGAAGAAAACGAGGATGATTGCAGCGACTGG
GATGAGCTACCTGCAAGCAACAATACTGTAGCGCAGCAAACACTCCTACTGGACCCTTCGGGAGGCACGACCCTA
GACTCCCAAAACAAGGCCATTGCTATCACCCATGACTCTGTCCGTGATGGGGACCAAGTATCTGCCGGGGCTGAA
GTTTTTCCAAAGGCCAATAAGCATCACAAGTCGCCTTCCGTGTCGACGTTGCCAGCACTTGGCTCAATAACGCAT
CCTGATCTTTCGACTCTCGAAAAATCTGCCTCAGCATCGTGTTCGGATCTGCGTCTGACATCTGCAGCAGACAGA
GTAGCGTCACCATCGAAATCATCATTGCGTGATGTTCGCGAAAGTCCGCTCAGACAGGTTAAGAACAAGTTATCC
TCGATGCTGAAGAGCTCGAGAGGGCTTCTTGCGAGTAGTGCAGCCGCCAGTGCAGAGGGGAAATTACTTCTGGTG
TCTCCATCTTCAGCTCCATCAGGATTTGACTCGGCAATCGCGGTAGAGCCTGAAGTCCCACTGGCTGCCGCACTT
GGACCGCAACAGAATACTGATGAAGGATCACCGCGGTCTGTTGCTCGACGCAGGAGAGCGTCCACCGAGAGAGAA
AAAGAGGAAAAGCGTAGAGAGAAAGAAGCCAAGTTGATACTGGACCAAAACGCCAAATTGCAAAAGGCTCGTGAA
AAAGAGAGAGAGAAGGCAATTGCGTTCAGCAAGGAGCATGAGCAGCGTGTTACACGAGAGAAATACACTGCCTCG
GAAGAAAAGAAGGCTGATTTGCCCATATGTATGGAAACGTCCAAGGTGATCGAAAGCAACTCCCAAAAAAATAGC
GACATTGTCAAATGCGACTCAAAAGAGGGCACCAACGATGACATCGAGATGCAAGATGCTCCTGCTCCCTCGGCT
CGTTCCGTTGGTCCATGCCAATCGACCCGCGCCGCGGAAATCAAACGGCCAGTCAAGCCCGCCAAAGAAACACAA
AGCAAGACGAAACAGGCTCCTACGCTGATCAGGGTCAACATGGGATCACAGCAGTCTCAATATCAGGGCGCGAAT
AGGTCTTCATTTGCCCAAGAAACACCAGGCTACTCGAACTCTCAGTCTCAACAAAGTCTTGCTGCTCGCACGAGT
AAAGCATCGCTACACGGCAAACCGGCAGTGCAAAGTTTGAGGGGGGCTCCTCCTAACGCGCGGACCAAGGCACTG
GACTTGGCGGCAAGGAAACGGGATCAAGAAGAACGTGAGGCACAACGTCGACGTGATGTCAAGACGGAGATGGAT
CGCAAGCGTGCAGCGCTTCAAGAGGAGCAGCGGAAGCAAGACACTCTACAGCGGCAGACAAAACATGGTCGAGAA
TCTGCTACAAGCCAAACTGAGGCTAAGAGAAAGGCAGCAGTGGAAAAGGCCAAGCATCTGAGGGCGCCCCCTCCT
GCTTTACGAACTCACGCCAATAATGCCCGTTCGGAAACTGTCTTACCCCAGGACCGCGTTTATTCCACAGCCTCG
AGTGCTAAGGGAGCGCTACAAAATAGCCGGCCACAGTCCCGTATGGCTTCCAATCTGCACCGCTCGCAAGACGAG
CTAAGCCGGCCCTTCAATGCAGTTTTATCAACTACGTCCAAGACTGGATCGAAGCGGGCTTTGGGTACAGAAGAT
GGCCACGTCAAGGGACAAGTGTCTCGGGTAGGGCCTGCGAACCAATCCAATGACGCCAAGAGGCGACGAACAAGC
GCTGGATATGACGACGAGACTGAGACTGAAACTGCACTCAAAATCAAGGGACCACCCGTGCGACCGTCAGGTGGC
CTGAAGAAGGATCTCCCGGCGAGACCAACCTATGGATACACAAGCTCGTCTCATGGTGTCCAAAGGGACTTGTTC
AAGGCCACGGTTACTGCGCAACACCACAATCAGACAAAGGCGGCGCATCCCCTAGACATGGCACAGATCTCAAAA
GGCCCAATTCCGTTTGCACCGACTAGCGCTGGCGTTGGAGCTTCACACAAGACACCGGCTCGTTCTGGGGGACTC
AATGCAGCCAAATCAACTGCTAGATCATCACCAAGGTTCCAGAATGGAGACTCGATTGAGCTTCCAGAAATCGAC
ACAGATGATGAGGATGAGGACGAGGATGATGCATATGGAACGCGTGTGGCGGCTTGGGCTGACTCTCCTGATTTG
CGACGAGCCCTAATGCGCCAGGAAACCATGGACCCTTCCAAGATCTTTGGTCCGGCAGCGCCACTCAACATGGAG
GAGGTTTTCAGCAAGAGTAAACATAGTTTCAGAGCCAGGACCTCGAGCGCCAACTGGAGCGGAGCAGACCGCTTA
ACCGAAGAGGAGATTTGTAGGGACCGTGAGGCTCGAGACAAGCTAAGGCGTGACGGGGGTTGGTCTTATGAGATG
AGCCGAGAGATGATTTAG
Transcript >OphauG2|5675
ATGCCATCCCATCATGTACCTGCCGAAGCTCTAGAAGAACCTCAAAATGCTATTTTTGACACCCTGTCTGCCTCA
GAAAAGGCTCTCGAAACAGCACCACTGTTGTCTGGCTTGCAGCAGGGCAATACTCAGAACGATGTCGGAAGCAGC
ACATCACCTTTTGCCGGTCAAAGTCTTACGCGACAAGGAATCGATATCCCAGACTCTGATTCGAAACCGTGCCAA
GCTATGGAACATCAAGCATTAAATGACTCCCATTCGCCATCAGACGGATCCAGCCCCATACGCCCAGTGGTCCGC
AAGAGTAGCTTGAACTTTGCTTCTCTGCCTGCTAGAGAACCACTTACCGCTGGTAAAAGCTTCGGGGCTCAAGTT
TCTCGAACGAGTCATATCGACCACACGCGGACGAGTCACTATAATCGACAAACAGGAGGCAAAAGTCTGGGCAAT
GTCGCAAAATCTGAGAGTGAGGACGATTTCGAGACAGCTGACATGAGACTACATCACGAATCTCGAGGTGGTGAT
AGCAGCAAGACATGTATCAGCCATGCCAAAACCTACACGCAAAGGCTACAAGACCATATTAGTAAACTAGGAAAA
AGCGATGAGACGGTGGCGACAGATTTTGAATCCTCGCAGCCACATCAATCTCTCGATCAGAAATCTCTGTCTCCC
GCAAAGAAAGGCAAATTACAGACAACACCAGGGGCATTTCCGAATGAAGAAAACGAGGATGATTGCAGCGACTGG
GATGAGCTACCTGCAAGCAACAATACTGTAGCGCAGCAAACACTCCTACTGGACCCTTCGGGAGGCACGACCCTA
GACTCCCAAAACAAGGCCATTGCTATCACCCATGACTCTGTCCGTGATGGGGACCAAGTATCTGCCGGGGCTGAA
GTTTTTCCAAAGGCCAATAAGCATCACAAGTCGCCTTCCGTGTCGACGTTGCCAGCACTTGGCTCAATAACGCAT
CCTGATCTTTCGACTCTCGAAAAATCTGCCTCAGCATCGTGTTCGGATCTGCGTCTGACATCTGCAGCAGACAGA
GTAGCGTCACCATCGAAATCATCATTGCGTGATGTTCGCGAAAGTCCGCTCAGACAGGTTAAGAACAAGTTATCC
TCGATGCTGAAGAGCTCGAGAGGGCTTCTTGCGAGTAGTGCAGCCGCCAGTGCAGAGGGGAAATTACTTCTGGTG
TCTCCATCTTCAGCTCCATCAGGATTTGACTCGGCAATCGCGGTAGAGCCTGAAGTCCCACTGGCTGCCGCACTT
GGACCGCAACAGAATACTGATGAAGGATCACCGCGGTCTGTTGCTCGACGCAGGAGAGCGTCCACCGAGAGAGAA
AAAGAGGAAAAGCGTAGAGAGAAAGAAGCCAAGTTGATACTGGACCAAAACGCCAAATTGCAAAAGGCTCGTGAA
AAAGAGAGAGAGAAGGCAATTGCGTTCAGCAAGGAGCATGAGCAGCGTGTTACACGAGAGAAATACACTGCCTCG
GAAGAAAAGAAGGCTGATTTGCCCATATGTATGGAAACGTCCAAGGTGATCGAAAGCAACTCCCAAAAAAATAGC
GACATTGTCAAATGCGACTCAAAAGAGGGCACCAACGATGACATCGAGATGCAAGATGCTCCTGCTCCCTCGGCT
CGTTCCGTTGGTCCATGCCAATCGACCCGCGCCGCGGAAATCAAACGGCCAGTCAAGCCCGCCAAAGAAACACAA
AGCAAGACGAAACAGGCTCCTACGCTGATCAGGGTCAACATGGGATCACAGCAGTCTCAATATCAGGGCGCGAAT
AGGTCTTCATTTGCCCAAGAAACACCAGGCTACTCGAACTCTCAGTCTCAACAAAGTCTTGCTGCTCGCACGAGT
AAAGCATCGCTACACGGCAAACCGGCAGTGCAAAGTTTGAGGGGGGCTCCTCCTAACGCGCGGACCAAGGCACTG
GACTTGGCGGCAAGGAAACGGGATCAAGAAGAACGTGAGGCACAACGTCGACGTGATGTCAAGACGGAGATGGAT
CGCAAGCGTGCAGCGCTTCAAGAGGAGCAGCGGAAGCAAGACACTCTACAGCGGCAGACAAAACATGGTCGAGAA
TCTGCTACAAGCCAAACTGAGGCTAAGAGAAAGGCAGCAGTGGAAAAGGCCAAGCATCTGAGGGCGCCCCCTCCT
GCTTTACGAACTCACGCCAATAATGCCCGTTCGGAAACTGTCTTACCCCAGGACCGCGTTTATTCCACAGCCTCG
AGTGCTAAGGGAGCGCTACAAAATAGCCGGCCACAGTCCCGTATGGCTTCCAATCTGCACCGCTCGCAAGACGAG
CTAAGCCGGCCCTTCAATGCAGTTTTATCAACTACGTCCAAGACTGGATCGAAGCGGGCTTTGGGTACAGAAGAT
GGCCACGTCAAGGGACAAGTGTCTCGGGTAGGGCCTGCGAACCAATCCAATGACGCCAAGAGGCGACGAACAAGC
GCTGGATATGACGACGAGACTGAGACTGAAACTGCACTCAAAATCAAGGGACCACCCGTGCGACCGTCAGGTGGC
CTGAAGAAGGATCTCCCGGCGAGACCAACCTATGGATACACAAGCTCGTCTCATGGTGTCCAAAGGGACTTGTTC
AAGGCCACGGTTACTGCGCAACACCACAATCAGACAAAGGCGGCGCATCCCCTAGACATGGCACAGATCTCAAAA
GGCCCAATTCCGTTTGCACCGACTAGCGCTGGCGTTGGAGCTTCACACAAGACACCGGCTCGTTCTGGGGGACTC
AATGCAGCCAAATCAACTGCTAGATCATCACCAAGGTTCCAGAATGGAGACTCGATTGAGCTTCCAGAAATCGAC
ACAGATGATGAGGATGAGGACGAGGATGATGCATATGGAACGCGTGTGGCGGCTTGGGCTGACTCTCCTGATTTG
CGACGAGCCCTAATGCGCCAGGAAACCATGGACCCTTCCAAGATCTTTGGTCCGGCAGCGCCACTCAACATGGAG
GAGGTTTTCAGCAAGAGTAAACATAGTTTCAGAGCCAGGACCTCGAGCGCCAACTGGAGCGGAGCAGACCGCTTA
ACCGAAGAGGAGATTTGTAGGGACCGTGAGGCTCGAGACAAGCTAAGGCGTGACGGGGGTTGGTCTTATGAGATG
AGCCGAGAGATGATTTAG
Gene >OphauG2|5675
ATGCCATCCCATCATGTACCTGCCGAAGCTCTAGAAGAACCTCAAAATGCTATTTTTGACACCCTGTCTGCCTCA
GAAAAGGCTCTCGAAACAGCACCACTGTTGTCTGGCTTGCAGCAGGGCAATACTCAGAACGATGTCGGAAGCAGC
ACATCACCTTTTGCCGGTCAAAGTCTTACGCGACAAGGAATCGATATCCCAGACTCTGATTCGAAACCGTGCCAA
GCTATGGAACATCAAGCATTAAATGACTCCCATTCGCCATCAGACGGATCCAGCCCCATACGCCCAGTGGTCCGC
AAGAGTAGCTTGAACTTTGCTTCTCTGCCTGCTAGAGAACCACTTACCGCTGGTAAAAGCTTCGGGGCTCAAGTT
TCTCGAACGAGTCATATCGACCACACGCGGACGAGTCACTATAATCGACAAACAGGAGGCAAAAGTCTGGGCAAT
GTCGCAAAATCTGAGAGTGAGGACGATTTCGAGACAGCTGACATGAGACTACATCACGAATCTCGAGGTGGTGAT
AGCAGCAAGACATGTATCAGCCATGCCAAAACCTACACGCAAAGGCTACAAGACCATATTAGTAAACTAGGAAAA
AGCGATGAGACGGTGGCGACAGATTTTGAATCCTCGCAGCCACATCAATCTCTCGATCAGAAATCTCTGTCTCCC
GCAAAGAAAGGCAAATTACAGACAACACCAGGGGCATTTCCGAATGAAGAAAACGAGGATGATTGCAGCGACTGG
GATGAGCTACCTGCAAGCAACAATACTGTAGCGCAGCAAACACTCCTACTGGACCCTTCGGGAGGCACGACCCTA
GACTCCCAAAACAAGGCCATTGCTATCACCCATGACTCTGTCCGTGATGGGGACCAAGTATCTGCCGGGGCTGAA
GTTTTTCCAAAGGCCAATAAGCATCACAAGTCGCCTTCCGTGTCGACGTTGCCAGCACTTGGCTCAATAACGCAT
CCTGATCTTTCGACTCTCGAAAAATCTGCCTCAGCATCGTGTTCGGATCTGCGTCTGACATCTGCAGCAGACAGA
GTAGCGTCACCATCGAAATCATCATTGCGTGATGTTCGCGAAAGTCCGCTCAGACAGGTTAAGAACAAGTTATCC
TCGATGCTGAAGAGCTCGAGAGGGCTTCTTGCGAGTAGTGCAGCCGCCAGTGCAGAGGGGAAATTACTTCTGGTG
TCTCCATCTTCAGCTCCATCAGGATTTGACTCGGCAATCGCGGTAGAGCCTGAAGTCCCACTGGCTGCCGCACTT
GGACCGCAACAGAATACTGATGAAGGATCACCGCGGTCTGTTGCTCGACGCAGGAGAGCGTCCACCGAGAGAGAA
AAAGAGGAAAAGCGTAGAGAGAAAGAAGCCAAGTTGATACTGGACCAAAACGCCAAATTGCAAAAGGCTCGTGAA
AAAGAGAGAGAGAAGGCAATTGCGTTCAGCAAGGAGCATGAGCAGCGTGTTACACGAGAGAAATACACTGCCTCG
GAAGAAAAGAAGGCTGATTTGCCCATATGTATGGAAACGTCCAAGGTGATCGAAAGCAACTCCCAAAAAAATAGC
GACATTGTCAAATGCGACTCAAAAGAGGGCACCAACGATGACATCGAGATGCAAGATGCTCCTGCTCCCTCGGCT
CGTTCCGTTGGTCCATGCCAATCGACCCGCGCCGCGGAAATCAAACGGCCAGTCAAGCCCGCCAAAGAAACACAA
AGCAAGACGAAACAGGCTCCTACGCTGATCAGGGTCAACATGGGATCACAGCAGTCTCAATATCAGGGCGCGAAT
AGGTCTTCATTTGCCCAAGAAACACCAGGCTACTCGAACTCTCAGTCTCAACAAAGTCTTGCTGCTCGCACGAGT
AAAGCATCGCTACACGGCAAACCGGCAGTGCAAAGTTTGAGGGGGGCTCCTCCTAACGCGCGGACCAAGGCACTG
GACTTGGCGGCAAGGAAACGGGATCAAGAAGAACGTGAGGCACAACGTCGACGTGATGTCAAGACGGAGATGGAT
CGCAAGCGTGCAGCGCTTCAAGAGGAGCAGCGGAAGCAAGACACTCTACAGCGGCAGACAAAACATGGTCGAGAA
TCTGCTACAAGCCAAACTGAGGCTAAGAGAAAGGCAGCAGTGGAAAAGGCCAAGCATCTGAGGGCGCCCCCTCCT
GCTTTACGAACTCACGCCAATAATGCCCGTTCGGAAACTGTCTTACCCCAGGACCGCGTTTATTCCACAGCCTCG
AGTGCTAAGGGAGCGCTACAAAATAGCCGGCCACAGTCCCGTATGGCTTCCAATCTGCACCGCTCGCAAGACGAG
CTAAGCCGGCCCTTCAATGCAGTTTTATCAACTACGTCCAAGACTGGATCGAAGCGGGCTTTGGGTACAGAAGAT
GGCCACGTCAAGGGACAAGTGTCTCGGGTAGGGCCTGCGAACCAATCCAATGACGCCAAGAGGCGACGAACAAGC
GCTGGATATGACGACGAGACTGAGACTGAAACTGCACTCAAAATCAAGGGACCACCCGTGCGACCGTCAGGTGGC
CTGAAGAAGGTAAGTTGCAACGTTTAAGCTTGGCACGAAGATTAAAGCTAATGACAGGAAGGATCTCCCGGCGAG
ACCAACCTATGGATACACAAGCTCGTCTCATGGTGTCCAAAGGGACTTGTTCAAGGCCACGGTTACTGCGCAACA
CCACAATCAGACAAAGGCGGCGCATCCCCTAGACATGGCACAGATCTCAAAAGGCCCAATTCCGTTTGCACCGAC
TAGCGCTGGCGTTGGAGCTTCACACAAGACACCGGCTCGTTCTGGGGGACTCAATGCAGCCAAATCAACTGCTAG
ATCATCACCAAGGTTCCAGAATGGAGACTCGATTGAGCTTCCAGAAATCGACACAGATGATGAGGATGAGGACGA
GGATGATGCATATGGAACGCGTGTGGCGGCTTGGGCTGACTCTCCTGATTTGCGACGAGCCCTAATGCGCCAGGA
AACCATGGACCCTTCCAAGATCTTTGGTCCGGCAGCGCCACTCAACATGGAGGAGGTTTTCAGCAAGAGTAAACA
TAGTTTCAGAGCCAGGACCTCGAGCGCCAACTGGAGCGGAGCAGACCGCTTAACCGAAGAGGAGATTTGTAGGGA
CCGTGAGGCTCGAGACAAGCTAAGGCGTGACGGGGGTTGGTCTTATGAGATGAGCCGAGAGATGATTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail