Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|567
Gene name
LocationContig_1135:3182..4939
Strand+
Gene length (bp)1757
Transcript length (bp)1677
Coding sequence length (bp)1677
Protein length (aa) 559

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10256 Erf4 Golgin subfamily A member 7/ERF4 family 1.5E-36 398 522

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10182|ERFD_SCHPO Ras modification protein erf4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erf4 PE=1 SV=1 398 521 9.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5828
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|567 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|177
Ophiocordyceps camponoti-floridani Ophcf2|04916
Ophiocordyceps camponoti-rufipedis Ophun1|5777
Ophiocordyceps kimflemingae Ophio5|669

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|567
MKRWKRAAAASQSQAGCVSGASRIEAGPGGSSSTACRAGLAAPEEAPADGLQQQRPPWPSTPSPATLPLPLPLHI
SASPAPPNPASPAPLPPLPSSPRSERGRPGGRAPGVFATAPHASHPSKVPVAAAAASASAASADAPSSALPLSHH
PVRPSNHLAAAAAAEALNPSTQPYIRPLPFKSRSPRRRRLSSARLWNPTNSTPRTPSRSRTRARRTSSPPAPAVP
LQHPALDQAAHCPSGDYPLLSLSQQRQAKHSPATRASFQIEQTASSDKRISLPRSVRLSHDLDVDAVISAIDHHS
RPDKGKARAAMVPAPHDDAAARHFSRDLERGPQVADARSSTVSDPPAIGSTVSSSDSSIMGQDVPADGGEEWGPQ
HPCYPHLNPHVPPDSLEYANTRVIRIRRDWLLHGDLAPTFSNLYPEILDPAGMSEQEFRSIIDKLNSELVPIFSP
WSMRNVVDGLLGLVTGWLWDDMGLTAVKSRLKTLDKWITQWNTDKQNAMAAEEGVMPPKIISLRQTAYMTLDIQI
PDPEIAPVPSTAGADQSGVDAAGPAEPSGSITA*
Coding >OphauG2|567
ATGAAGAGGTGGAAGCGTGCGGCGGCGGCCAGCCAATCACAGGCGGGATGCGTGTCGGGCGCTAGCCGGATAGAG
GCCGGGCCTGGGGGCAGCTCGTCGACAGCGTGTCGGGCAGGCCTGGCGGCCCCTGAAGAAGCCCCTGCAGACGGG
CTGCAGCAGCAACGGCCGCCATGGCCGTCAACACCAAGCCCAGCGACTCTGCCACTGCCTTTGCCACTACACATC
TCGGCCTCGCCCGCCCCCCCCAACCCGGCCTCTCCTGCGCCGCTCCCGCCCTTGCCCTCGTCGCCTCGGTCTGAG
CGCGGTCGTCCCGGCGGCCGTGCCCCAGGCGTCTTTGCCACGGCTCCTCACGCCTCGCACCCGTCCAAAGTGCCT
GTTGCTGCCGCTGCTGCTTCTGCGTCGGCTGCGTCTGCAGACGCCCCCTCTAGCGCTCTGCCGCTGTCTCACCAC
CCCGTCCGTCCCTCGAACCATCTCGCCGCTGCTGCTGCTGCAGAGGCTCTGAATCCCTCTACCCAGCCCTACATC
CGGCCCTTGCCCTTCAAGAGCCGCTCGCCCCGCCGCCGCCGTCTGTCGTCGGCTCGCCTGTGGAATCCTACAAAC
TCGACGCCTCGCACCCCGTCGCGCTCCCGCACCAGAGCCCGACGCACTTCATCGCCCCCCGCCCCGGCGGTGCCG
CTGCAGCATCCTGCCCTCGACCAGGCTGCCCATTGCCCCTCGGGCGACTATCCCCTGCTGTCGCTCTCCCAGCAG
CGCCAGGCAAAGCACTCGCCCGCCACCCGAGCCAGCTTCCAGATTGAACAGACGGCCAGCAGCGACAAACGCATC
AGCCTCCCGCGCTCTGTCCGCCTGTCGCACGACCTCGACGTCGACGCCGTCATCAGCGCCATTGACCACCATTCC
CGCCCGGACAAGGGAAAAGCAAGGGCCGCCATGGTGCCAGCGCCCCACGACGATGCCGCCGCCAGGCACTTCTCG
CGAGACCTGGAGCGCGGCCCCCAAGTGGCCGATGCCCGCTCCTCCACCGTCTCTGACCCGCCAGCCATTGGCTCC
ACCGTGTCGTCGTCAGACTCGTCCATCATGGGCCAAGACGTGCCCGCCGACGGCGGTGAGGAATGGGGCCCGCAG
CACCCGTGCTATCCCCACCTCAACCCCCATGTGCCTCCCGACTCGCTCGAGTACGCCAACACGCGCGTCATCCGC
ATCCGACGCGACTGGCTGCTCCACGGCGACCTGGCACCCACCTTTTCCAATCTCTACCCCGAGATCCTCGACCCC
GCTGGCATGTCGGAGCAAGAGTTTAGGAGCATCATCGACAAGCTCAACAGCGAGCTGGTGCCCATTTTCAGCCCG
TGGTCCATGCGCAACGTCGTGGACGGCCTCTTGGGGCTTGTCACGGGCTGGCTGTGGGACGACATGGGTCTCACC
GCCGTCAAGTCTCGCCTCAAGACCCTCGACAAGTGGATCACGCAGTGGAACACGGACAAGCAAAACGCCATGGCT
GCCGAGGAGGGTGTCATGCCGCCCAAGATTATCTCGCTCCGCCAGACGGCTTACATGACGCTCGATATCCAAATC
CCGGACCCTGAAATCGCTCCTGTGCCCAGCACTGCAGGCGCCGACCAGTCGGGCGTAGATGCGGCCGGGCCGGCG
GAACCATCAGGCTCCATTACAGCGTAA
Transcript >OphauG2|567
ATGAAGAGGTGGAAGCGTGCGGCGGCGGCCAGCCAATCACAGGCGGGATGCGTGTCGGGCGCTAGCCGGATAGAG
GCCGGGCCTGGGGGCAGCTCGTCGACAGCGTGTCGGGCAGGCCTGGCGGCCCCTGAAGAAGCCCCTGCAGACGGG
CTGCAGCAGCAACGGCCGCCATGGCCGTCAACACCAAGCCCAGCGACTCTGCCACTGCCTTTGCCACTACACATC
TCGGCCTCGCCCGCCCCCCCCAACCCGGCCTCTCCTGCGCCGCTCCCGCCCTTGCCCTCGTCGCCTCGGTCTGAG
CGCGGTCGTCCCGGCGGCCGTGCCCCAGGCGTCTTTGCCACGGCTCCTCACGCCTCGCACCCGTCCAAAGTGCCT
GTTGCTGCCGCTGCTGCTTCTGCGTCGGCTGCGTCTGCAGACGCCCCCTCTAGCGCTCTGCCGCTGTCTCACCAC
CCCGTCCGTCCCTCGAACCATCTCGCCGCTGCTGCTGCTGCAGAGGCTCTGAATCCCTCTACCCAGCCCTACATC
CGGCCCTTGCCCTTCAAGAGCCGCTCGCCCCGCCGCCGCCGTCTGTCGTCGGCTCGCCTGTGGAATCCTACAAAC
TCGACGCCTCGCACCCCGTCGCGCTCCCGCACCAGAGCCCGACGCACTTCATCGCCCCCCGCCCCGGCGGTGCCG
CTGCAGCATCCTGCCCTCGACCAGGCTGCCCATTGCCCCTCGGGCGACTATCCCCTGCTGTCGCTCTCCCAGCAG
CGCCAGGCAAAGCACTCGCCCGCCACCCGAGCCAGCTTCCAGATTGAACAGACGGCCAGCAGCGACAAACGCATC
AGCCTCCCGCGCTCTGTCCGCCTGTCGCACGACCTCGACGTCGACGCCGTCATCAGCGCCATTGACCACCATTCC
CGCCCGGACAAGGGAAAAGCAAGGGCCGCCATGGTGCCAGCGCCCCACGACGATGCCGCCGCCAGGCACTTCTCG
CGAGACCTGGAGCGCGGCCCCCAAGTGGCCGATGCCCGCTCCTCCACCGTCTCTGACCCGCCAGCCATTGGCTCC
ACCGTGTCGTCGTCAGACTCGTCCATCATGGGCCAAGACGTGCCCGCCGACGGCGGTGAGGAATGGGGCCCGCAG
CACCCGTGCTATCCCCACCTCAACCCCCATGTGCCTCCCGACTCGCTCGAGTACGCCAACACGCGCGTCATCCGC
ATCCGACGCGACTGGCTGCTCCACGGCGACCTGGCACCCACCTTTTCCAATCTCTACCCCGAGATCCTCGACCCC
GCTGGCATGTCGGAGCAAGAGTTTAGGAGCATCATCGACAAGCTCAACAGCGAGCTGGTGCCCATTTTCAGCCCG
TGGTCCATGCGCAACGTCGTGGACGGCCTCTTGGGGCTTGTCACGGGCTGGCTGTGGGACGACATGGGTCTCACC
GCCGTCAAGTCTCGCCTCAAGACCCTCGACAAGTGGATCACGCAGTGGAACACGGACAAGCAAAACGCCATGGCT
GCCGAGGAGGGTGTCATGCCGCCCAAGATTATCTCGCTCCGCCAGACGGCTTACATGACGCTCGATATCCAAATC
CCGGACCCTGAAATCGCTCCTGTGCCCAGCACTGCAGGCGCCGACCAGTCGGGCGTAGATGCGGCCGGGCCGGCG
GAACCATCAGGCTCCATTACAGCGTAA
Gene >OphauG2|567
ATGAAGAGGTGGAAGCGTGCGGCGGCGGCCAGCCAATCACAGGCGGGATGCGTGTCGGGCGCTAGCCGGATAGAG
GCCGGGCCTGGGGGCAGCTCGTCGACAGCGTGTCGGGCAGGCCTGGCGGCCCCTGAAGAAGCCCCTGCAGACGGG
CTGCAGCAGCAACGGCCGCCATGGCCGTCAACACCAAGCCCAGCGACTCTGCCACTGCCTTTGCCACTACACATC
TCGGCCTCGCCCGCCCCCCCCAACCCGGCCTCTCCTGCGCCGCTCCCGCCCTTGCCCTCGTCGCCTCGGTCTGAG
CGCGGTCGTCCCGGCGGCCGTGCCCCAGGCGTCTTTGCCACGGCTCCTCACGCCTCGCACCCGTCCAAAGTGCCT
GTTGCTGCCGCTGCTGCTTCTGCGTCGGCTGCGTCTGCAGACGCCCCCTCTAGCGCTCTGCCGCTGTCTCACCAC
CCCGTCCGTCCCTCGAACCATCTCGCCGCTGCTGCTGCTGCAGAGGCTCTGAATCCCTCTACCCAGCCCTACATC
CGGCCCTTGCCCTTCAAGAGCCGCTCGCCCCGCCGCCGCCGTCTGTCGTCGGCTCGCCTGTGGAATCCTACAAAC
TCGACGCCTCGCACCCCGTCGCGCTCCCGCACCAGAGCCCGACGCACTTCATCGCCCCCCGCCCCGGCGGTGCCG
CTGCAGCATCCTGCCCTCGACCAGGCTGCCCATTGCCCCTCGGGCGACTATCCCCTGCTGTCGCTCTCCCAGCAG
CGCCAGGCAAAGCACTCGCCCGCCACCCGAGCCAGCTTCCAGATTGAACAGACGGCCAGCAGCGACAAACGCATC
AGCCTCCCGCGCTCTGTCCGCCTGTCGCACGACCTCGACGTCGACGCCGTCATCAGCGCCATTGACCACCATTCC
CGCCCGGACAAGGGAAAAGCAAGGGCCGCCATGGTGCCAGCGCCCCACGACGATGCCGCCGCCAGGCACTTCTCG
CGAGACCTGGAGCGCGGCCCCCAAGTGGCCGATGCCCGCTCCTCCACCGTCTCTGACCCGCCAGCCATTGGCTCC
ACCGTGTCGTCGTCAGACTCGTCCATCATGGGCCAAGACGTGCCCGCCGACGGCGGTGAGGAATGGGGCCCGCAG
CACCCGTGCTATCCCCACCTCAACCCCCATGTGCCTCCCGACTCGCTCGAGTACGCCAACACGCGCGTCATCCGC
ATCCGACGCGACTGGCTGCTCCACGGCGACCTGGCACCCACCTTTTCCAATCTCTACCCCGAGATCCTCGACCCC
GCTGGCATGTCGGAGCAAGAGTTTAGGAGCATCATCGACAAGCTCAACAGCGAGCTGGTGCCCATTTTCAGCCCG
TGGTCCATGCGCAACGTCGTGGACGGCCTCTTGGGGCTTGTCACGGGCTGGCTGTGGGACGACATGGGTCTCACC
GCCGTCAAGTCTCGCCTCAAGACCCTCGACAAGTGGATCACGCAGTGGAACACGGACAAGCAAAACGCCATGGCT
GCCGAGGAGGGTGTCATGCCGCCCAAGATTATCTCGCTCCGCCAGACGGCTTACATGACGGTTGGTTCCAATTCA
TCCATTTTTTCTCTCGTTATTCTTCTTGGCCACGCCACCTTGCTGACTGCCTCTTGCACACGCAGCTCGATATCC
AAATCCCGGACCCTGAAATCGCTCCTGTGCCCAGCACTGCAGGCGCCGACCAGTCGGGCGTAGATGCGGCCGGGC
CGGCGGAACCATCAGGCTCCATTACAGCGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail