Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5662
Gene name
LocationContig_531:3571..7360
Strand+
Gene length (bp)3789
Transcript length (bp)3657
Coding sequence length (bp)3657
Protein length (aa) 1219

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00562 RNA_pol_Rpb2_6 RNA polymerase Rpb2, domain 6 1.6E-110 687 1065
PF04565 RNA_pol_Rpb2_3 RNA polymerase Rpb2, domain 3 4.3E-29 477 541
PF04561 RNA_pol_Rpb2_2 RNA polymerase Rpb2, domain 2 5.6E-23 188 387
PF06883 RNA_pol_Rpa2_4 RNA polymerase I, Rpa2 specific domain 7.5E-23 581 638
PF04563 RNA_pol_Rpb2_1 RNA polymerase beta subunit 1.7E-13 145 419
PF04560 RNA_pol_Rpb2_7 RNA polymerase Rpb2, domain 7 1.1E-12 1067 1158

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74633|RPA2_NEUCR DNA-directed RNA polymerase I subunit RPA2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acr-2 PE=1 SV=2 7 1206 0.0E+00
sp|Q75DS1|RPA2_ASHGO DNA-directed RNA polymerase I subunit RPA2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPA2 PE=3 SV=2 21 1195 0.0E+00
sp|P22138|RPA2_YEAST DNA-directed RNA polymerase I subunit RPA135 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPA135 PE=1 SV=1 4 1195 0.0E+00
sp|Q9P7X8|RPA2_SCHPO Probable DNA-directed RNA polymerase I subunit RPA2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpa2 PE=3 SV=2 22 1195 0.0E+00
sp|Q54BM1|RPA2_DICDI DNA-directed RNA polymerase I subunit rpa2 OS=Dictyostelium discoideum GN=polr1b PE=3 SV=1 135 1195 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74633|RPA2_NEUCR DNA-directed RNA polymerase I subunit RPA2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acr-2 PE=1 SV=2 7 1206 0.0E+00
sp|Q75DS1|RPA2_ASHGO DNA-directed RNA polymerase I subunit RPA2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPA2 PE=3 SV=2 21 1195 0.0E+00
sp|P22138|RPA2_YEAST DNA-directed RNA polymerase I subunit RPA135 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPA135 PE=1 SV=1 4 1195 0.0E+00
sp|Q9P7X8|RPA2_SCHPO Probable DNA-directed RNA polymerase I subunit RPA2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpa2 PE=3 SV=2 22 1195 0.0E+00
sp|Q54BM1|RPA2_DICDI DNA-directed RNA polymerase I subunit rpa2 OS=Dictyostelium discoideum GN=polr1b PE=3 SV=1 135 1195 0.0E+00
sp|Q9H9Y6|RPA2_HUMAN DNA-directed RNA polymerase I subunit RPA2 OS=Homo sapiens GN=POLR1B PE=1 SV=2 43 1195 0.0E+00
sp|P70700|RPA2_MOUSE DNA-directed RNA polymerase I subunit RPA2 OS=Mus musculus GN=Polr1b PE=1 SV=2 34 1195 0.0E+00
sp|Q5REE8|RPA2_PONAB DNA-directed RNA polymerase I subunit RPA2 OS=Pongo abelii GN=POLR1B PE=2 SV=1 43 1195 0.0E+00
sp|P28365|RPA2_EUPOC DNA-directed RNA polymerase I subunit RPA2 OS=Euplotes octocarinatus GN=RPA2 PE=3 SV=2 99 1195 0.0E+00
sp|O54888|RPA2_RAT DNA-directed RNA polymerase I subunit RPA2 OS=Rattus norvegicus GN=Polr1b PE=1 SV=1 34 1195 0.0E+00
sp|P20028|RPA2_DROME DNA-directed RNA polymerase I subunit RPA2 OS=Drosophila melanogaster GN=RpI135 PE=2 SV=2 73 1195 0.0E+00
sp|F4I366|NRPA2_ARATH DNA-directed RNA polymerase I subunit 2 OS=Arabidopsis thaliana GN=NRPA2 PE=2 SV=1 90 1200 0.0E+00
sp|Q9NW08|RPC2_HUMAN DNA-directed RNA polymerase III subunit RPC2 OS=Homo sapiens GN=POLR3B PE=1 SV=2 40 1108 3.0E-123
sp|P59470|RPC2_MOUSE DNA-directed RNA polymerase III subunit RPC2 OS=Mus musculus GN=Polr3b PE=1 SV=2 40 1108 6.0E-123
sp|F4KD38|NRPC2_ARATH DNA-directed RNA polymerase III subunit 2 OS=Arabidopsis thaliana GN=NRPC2 PE=2 SV=1 15 1108 2.0E-118
sp|P25167|RPC2_DROME DNA-directed RNA polymerase III subunit RPC2 OS=Drosophila melanogaster GN=RpIII128 PE=2 SV=2 40 1142 2.0E-113
sp|Q42877|RPB2_SOLLC DNA-directed RNA polymerase II subunit RPB2 OS=Solanum lycopersicum GN=RPB2 PE=2 SV=1 102 1189 1.0E-107
sp|P22276|RPC2_YEAST DNA-directed RNA polymerase III subunit RPC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RET1 PE=1 SV=2 40 1108 9.0E-107
sp|P38420|NRPB2_ARATH DNA-directed RNA polymerase II subunit 2 OS=Arabidopsis thaliana GN=NRPB2 PE=1 SV=2 145 1189 6.0E-106
sp|P30876|RPB2_HUMAN DNA-directed RNA polymerase II subunit RPB2 OS=Homo sapiens GN=POLR2B PE=1 SV=1 107 1108 5.0E-105
sp|Q8CFI7|RPB2_MOUSE DNA-directed RNA polymerase II subunit RPB2 OS=Mus musculus GN=Polr2b PE=1 SV=2 107 1108 1.0E-104
sp|Q10233|RPC2_SCHPO DNA-directed RNA polymerase III subunit RPC2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc2 PE=2 SV=1 121 1108 3.0E-103
sp|Q54J75|RPB2_DICDI DNA-directed RNA polymerase II subunit rpb2 OS=Dictyostelium discoideum GN=polr2b PE=3 SV=1 145 1189 4.0E-102
sp|Q10578|RPB2_CAEEL DNA-directed RNA polymerase II subunit RPB2 OS=Caenorhabditis elegans GN=rpb-2 PE=2 SV=2 107 1189 6.0E-102
sp|P31814|RPOB_THECE DNA-directed RNA polymerase subunit B OS=Thermococcus celer GN=rpoB PE=3 SV=1 95 1108 4.0E-100
sp|P11513|RPOB_SULAC DNA-directed RNA polymerase subunit B OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpoB PE=3 SV=2 88 1108 3.0E-97
sp|Q60181|RPOB1_METJA DNA-directed RNA polymerase subunit B' OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpoB1 PE=3 SV=1 640 1110 1.0E-95
sp|Q8SR75|RPB2_ENCCU DNA-directed RNA polymerase II subunit RPB2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPB2 PE=3 SV=1 145 1108 3.0E-95
sp|O28392|RPOB1_ARCFU DNA-directed RNA polymerase subunit B' OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpoB1 PE=4 SV=1 640 1108 3.0E-93
sp|O27124|RPOB1_METTH DNA-directed RNA polymerase subunit B' OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpoB1 PE=3 SV=1 574 1108 3.0E-92
sp|P09845|RPOB1_METTW DNA-directed RNA polymerase subunit B' OS=Methanothermobacter thermautotrophicus (strain Winter) GN=rpoB1 PE=3 SV=2 640 1108 1.0E-91
sp|Q03587|RPOB_THEAC DNA-directed RNA polymerase subunit B OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpoB PE=3 SV=1 163 1104 5.0E-90
sp|P41557|RPOB1_METVS DNA-directed RNA polymerase subunit B' OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpoB1 PE=3 SV=2 649 1110 9.0E-86
sp|A5DHT2|RPB2_PICGU DNA-directed RNA polymerase II subunit RPB2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RPB2 PE=3 SV=3 675 1204 3.0E-85
sp|Q02061|RPB2_SCHPO DNA-directed RNA polymerase II subunit RPB2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpb2 PE=1 SV=2 674 1189 7.0E-85
sp|P0CX03|RPOB1_HALSA DNA-directed RNA polymerase subunit B' OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpoB1 PE=3 SV=1 643 1136 3.0E-84
sp|B0R8D5|RPOB1_HALS3 DNA-directed RNA polymerase subunit B' OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpoB1 PE=1 SV=1 643 1136 3.0E-84
sp|Q54IZ9|RPC2_DICDI DNA-directed RNA polymerase III subunit rpc2 OS=Dictyostelium discoideum GN=polr3b PE=3 SV=1 673 1108 5.0E-84
sp|Q6FLD5|RPB2_CANGA DNA-directed RNA polymerase II subunit RPB2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPB2 PE=3 SV=1 674 1108 7.0E-83
sp|Q197F1|RPB2_IIV3 Probable DNA-directed RNA polymerase II subunit RPB2 homolog OS=Invertebrate iridescent virus 3 GN=IIV3-009R PE=3 SV=1 76 1192 7.0E-83
sp|P08518|RPB2_YEAST DNA-directed RNA polymerase II subunit RPB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPB2 PE=1 SV=2 674 1108 2.0E-82
sp|P08266|RPB2_DROME DNA-directed RNA polymerase II subunit RPB2 OS=Drosophila melanogaster GN=RpII140 PE=2 SV=2 640 1189 4.0E-82
sp|Q753Q4|RPB2_ASHGO DNA-directed RNA polymerase II subunit RPB2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPB2 PE=3 SV=1 674 1189 4.0E-81
sp|Q91F97|RPB2_IIV6 Probable DNA-directed RNA polymerase II subunit RPB2 homolog OS=Invertebrate iridescent virus 6 GN=IIV6-428L PE=3 SV=1 91 1195 4.0E-78
sp|Q7T6X7|RPO2_MIMIV DNA-directed RNA polymerase subunit 2 OS=Acanthamoeba polyphaga mimivirus GN=RPO2 PE=1 SV=2 169 1197 8.0E-77
sp|Q9LV32|RPD2B_ARATH DNA-directed RNA polymerase D subunit 2b OS=Arabidopsis thaliana GN=NRPD2b PE=2 SV=1 353 1193 4.0E-74
sp|Q9LK40|NRPD2_ARATH DNA-directed RNA polymerases IV and V subunit 2 OS=Arabidopsis thaliana GN=NRPD2 PE=1 SV=1 355 1193 2.0E-71
sp|P0C8K3|RPB2_ASFM2 DNA-directed RNA polymerase subunit 2 OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-061 PE=3 SV=1 51 1138 3.0E-68
sp|Q6GZR3|RPB2_FRG3G Putative DNA-directed RNA polymerase II subunit RPB2 homolog OS=Frog virus 3 (isolate Goorha) GN=FV3-062L PE=3 SV=1 169 1194 7.0E-64
sp|P0C8K2|RPB2_ASFK5 DNA-directed RNA polymerase subunit 2 OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-065 PE=3 SV=1 674 1138 2.0E-58
sp|P42487|RPB2_ASFB7 DNA-directed RNA polymerase subunit 2 OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=Ba71V-053 PE=3 SV=1 674 1138 4.0E-58
sp|P0C8K5|RPB2_ASFWA DNA-directed RNA polymerase subunit 2 OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-063 PE=3 SV=1 674 1138 5.0E-58
sp|P0C8K4|RPB2_ASFP4 DNA-directed RNA polymerase subunit 2 OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-065 PE=3 SV=1 674 1138 5.0E-58
sp|Q110H1|RPOB_TRIEI DNA-directed RNA polymerase subunit beta OS=Trichodesmium erythraeum (strain IMS101) GN=rpoB PE=3 SV=1 471 1161 1.0E-37
sp|P47767|RPOB_SPICI DNA-directed RNA polymerase subunit beta OS=Spiroplasma citri GN=rpoB PE=3 SV=1 466 1129 6.0E-37
sp|Q8DL55|RPOB_THEEB DNA-directed RNA polymerase subunit beta OS=Thermosynechococcus elongatus (strain BP-1) GN=rpoB PE=3 SV=1 755 1101 6.0E-37
sp|Q85FR7|RPOB_CYAME DNA-directed RNA polymerase subunit beta OS=Cyanidioschyzon merolae GN=rpoB PE=3 SV=1 755 1097 7.0E-37
sp|A8MLD2|RPOB_ALKOO DNA-directed RNA polymerase subunit beta OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpoB PE=3 SV=1 755 1146 1.0E-36
sp|Q04E85|RPOB_OENOB DNA-directed RNA polymerase subunit beta OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpoB PE=3 SV=1 755 1122 2.0E-36
sp|Q49V52|RPOB_STAS1 DNA-directed RNA polymerase subunit beta OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpoB PE=3 SV=1 469 1097 3.0E-36
sp|Q2RFN9|RPOB_MOOTA DNA-directed RNA polymerase subunit beta OS=Moorella thermoacetica (strain ATCC 39073) GN=rpoB PE=3 SV=1 670 1097 3.0E-36
sp|B1MVW8|RPOB_LEUCK DNA-directed RNA polymerase subunit beta OS=Leuconostoc citreum (strain KM20) GN=rpoB PE=3 SV=1 755 1122 4.0E-36
sp|Q03V60|RPOB_LEUMM DNA-directed RNA polymerase subunit beta OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpoB PE=3 SV=1 755 1122 4.0E-36
sp|B8G1V8|RPOB_DESHD DNA-directed RNA polymerase subunit beta OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rpoB PE=3 SV=1 755 1097 6.0E-36
sp|Q250P0|RPOB_DESHY DNA-directed RNA polymerase subunit beta OS=Desulfitobacterium hafniense (strain Y51) GN=rpoB PE=3 SV=2 755 1097 6.0E-36
sp|Q88XZ3|RPOB_LACPL DNA-directed RNA polymerase subunit beta OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpoB PE=3 SV=2 755 1122 1.0E-35
sp|P16716|RP132_SHEVK DNA-directed RNA polymerase 132 kDa polypeptide (Fragment) OS=Sheeppox virus (strain KS-1) GN=RPO132 PE=3 SV=1 697 1131 1.0E-35
sp|Q775Q3|RP132_CAMPS DNA-directed RNA polymerase 132 kDa polypeptide OS=Camelpox virus (strain CMS) GN=RPO132 PE=3 SV=1 697 1133 1.0E-35
sp|Q8V2N1|RP132_CAMPM DNA-directed RNA polymerase 132 kDa polypeptide OS=Camelpox virus (strain M-96) GN=RPO132 PE=3 SV=1 697 1133 1.0E-35
sp|Q5MZ23|RPOB_SYNP6 DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rpoB PE=3 SV=1 755 1145 1.0E-35
sp|Q31N17|RPOB_SYNE7 DNA-directed RNA polymerase subunit beta OS=Synechococcus elongatus (strain PCC 7942) GN=rpoB PE=3 SV=1 755 1145 1.0E-35
sp|Q9J544|RP132_FOWPN DNA-directed RNA polymerase 132 kDa polypeptide OS=Fowlpox virus (strain NVSL) GN=RPO132 PE=3 SV=1 503 1133 1.0E-35
sp|Q18CF1|RPOB_PEPD6 DNA-directed RNA polymerase subunit beta OS=Peptoclostridium difficile (strain 630) GN=rpoB PE=3 SV=1 755 1097 1.0E-35
sp|Q2JX64|RPOB_SYNJA DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain JA-3-3Ab) GN=rpoB PE=3 SV=1 471 1097 1.0E-35
sp|B9MQG5|RPOB_CALBD DNA-directed RNA polymerase subunit beta OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rpoB PE=3 SV=1 755 1165 1.0E-35
sp|A8YXJ8|RPOB_LACH4 DNA-directed RNA polymerase subunit beta OS=Lactobacillus helveticus (strain DPC 4571) GN=rpoB PE=3 SV=1 471 1097 1.0E-35
sp|P22703|RPOB_NOSS1 DNA-directed RNA polymerase subunit beta OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rpoB PE=3 SV=2 755 1101 2.0E-35
sp|Q8V4V3|RP132_MONPV DNA-directed RNA polymerase 132 kDa polypeptide OS=Monkeypox virus GN=RPO132 PE=3 SV=1 697 1133 3.0E-35
sp|Q9MUS5|RPOB_MESVI DNA-directed RNA polymerase subunit beta OS=Mesostigma viride GN=rpoB PE=3 SV=1 755 1097 3.0E-35
sp|Q3M5D0|RPOB_ANAVT DNA-directed RNA polymerase subunit beta OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rpoB PE=3 SV=1 755 1101 4.0E-35
sp|Q80DV1|RP132_CWPXG DNA-directed RNA polymerase 132 kDa polypeptide OS=Cowpox virus (strain GRI-90 / Grishak) GN=RPO132 PE=3 SV=1 697 1133 5.0E-35
sp|A3DIZ4|RPOB_CLOTH DNA-directed RNA polymerase subunit beta OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpoB PE=3 SV=1 631 1097 7.0E-35
sp|O57230|RP132_VACCA DNA-directed RNA polymerase 133 kDa polypeptide OS=Vaccinia virus (strain Ankara) GN=RPO132 PE=3 SV=1 697 1133 7.0E-35
sp|P17474|RP132_CWPXB DNA-directed RNA polymerase 132 kDa polypeptide OS=Cowpox virus (strain Brighton Red) GN=RPO132 PE=3 SV=1 697 1133 7.0E-35
sp|A5VLL4|RPOB_LACRD DNA-directed RNA polymerase subunit beta OS=Lactobacillus reuteri (strain DSM 20016) GN=rpoB PE=3 SV=1 755 1122 7.0E-35
sp|Q6RZF8|RP132_RABPU DNA-directed RNA polymerase 132 kDa polypeptide OS=Rabbitpox virus (strain Utrecht) GN=RPO132 PE=3 SV=1 697 1133 8.0E-35
sp|Q8JL90|RP132_ECTVM DNA-directed RNA polymerase 132 kDa polypeptide OS=Ectromelia virus (strain Moscow) GN=RPO132 PE=3 SV=1 697 1133 8.0E-35
sp|A4XI30|RPOB_CALS8 DNA-directed RNA polymerase subunit beta OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpoB PE=3 SV=1 755 1097 8.0E-35
sp|C0ZIH0|RPOB_BREBN DNA-directed RNA polymerase subunit beta OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rpoB PE=3 SV=1 755 1097 1.0E-34
sp|B2S092|RPOB_BORHD DNA-directed RNA polymerase subunit beta OS=Borrelia hermsii (strain HS1 / DAH) GN=rpoB PE=3 SV=1 755 1127 1.0E-34
sp|P33811|RP132_VAR67 DNA-directed RNA polymerase 133 kDa polypeptide OS=Variola virus (isolate Human/India/Ind3/1967) GN=RPO132 PE=3 SV=3 697 1133 1.0E-34
sp|Q76ZP7|RP132_VACCW DNA-directed RNA polymerase 133 kDa polypeptide OS=Vaccinia virus (strain Western Reserve) GN=RPO132 PE=1 SV=1 697 1133 1.0E-34
sp|P68694|RP132_VACCC DNA-directed RNA polymerase 133 kDa polypeptide OS=Vaccinia virus (strain Copenhagen) GN=RPO132 PE=3 SV=1 697 1133 1.0E-34
sp|Q03EA9|RPOB_PEDPA DNA-directed RNA polymerase subunit beta OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpoB PE=3 SV=1 755 1097 1.0E-34
sp|C4KZQ4|RPOB_EXISA DNA-directed RNA polymerase subunit beta OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rpoB PE=3 SV=1 755 1097 1.0E-34
sp|Q9JF79|RP132_VACCT DNA-directed RNA polymerase 133 kDa polypeptide OS=Vaccinia virus (strain Tian Tan) GN=RPO132 PE=3 SV=1 697 1133 1.0E-34
sp|Q6F0L7|RPOB_MESFL DNA-directed RNA polymerase subunit beta OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rpoB PE=3 SV=1 755 1127 2.0E-34
sp|B5RLU9|RPOB_BORDL DNA-directed RNA polymerase subunit beta OS=Borrelia duttonii (strain Ly) GN=rpoB PE=3 SV=1 755 1127 2.0E-34
sp|B5RRJ7|RPOB_BORRA DNA-directed RNA polymerase subunit beta OS=Borrelia recurrentis (strain A1) GN=rpoB PE=3 SV=1 755 1127 2.0E-34
sp|Q1GBM5|RPOB_LACDA DNA-directed RNA polymerase subunit beta OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpoB PE=3 SV=1 755 1097 2.0E-34
sp|Q04C22|RPOB_LACDB DNA-directed RNA polymerase subunit beta OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpoB PE=3 SV=2 755 1097 2.0E-34
sp|Q046D2|RPOB_LACGA DNA-directed RNA polymerase subunit beta OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpoB PE=3 SV=1 755 1097 2.0E-34
sp|Q74L95|RPOB_LACJO DNA-directed RNA polymerase subunit beta OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpoB PE=3 SV=1 755 1097 3.0E-34
sp|A1QZH7|RPOB_BORT9 DNA-directed RNA polymerase subunit beta OS=Borrelia turicatae (strain 91E135) GN=rpoB PE=3 SV=1 755 1127 3.0E-34
sp|Q5WLS0|RPOB_BACSK DNA-directed RNA polymerase subunit beta OS=Bacillus clausii (strain KSM-K16) GN=rpoB PE=3 SV=1 755 1097 4.0E-34
sp|Q1AU22|RPOB_RUBXD DNA-directed RNA polymerase subunit beta OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rpoB PE=3 SV=1 471 1097 4.0E-34
sp|O78485|RPOB_GUITH DNA-directed RNA polymerase subunit beta OS=Guillardia theta GN=rpoB PE=3 SV=1 755 1127 4.0E-34
sp|Q1WVA5|RPOB_LACS1 DNA-directed RNA polymerase subunit beta OS=Lactobacillus salivarius (strain UCC118) GN=rpoB PE=3 SV=1 755 1122 4.0E-34
sp|Q03PU9|RPOB_LACBA DNA-directed RNA polymerase subunit beta OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpoB PE=3 SV=1 755 1097 5.0E-34
sp|Q9Z9M2|RPOB_BACHD DNA-directed RNA polymerase subunit beta OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpoB PE=3 SV=1 755 1097 6.0E-34
sp|A9VP69|RPOB_BACWK DNA-directed RNA polymerase subunit beta OS=Bacillus weihenstephanensis (strain KBAB4) GN=rpoB PE=3 SV=1 471 1097 6.0E-34
sp|Q5FM97|RPOB_LACAC DNA-directed RNA polymerase subunit beta OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rpoB PE=3 SV=1 471 1097 7.0E-34
sp|B1HMZ6|RPOB_LYSSC DNA-directed RNA polymerase subunit beta OS=Lysinibacillus sphaericus (strain C3-41) GN=rpoB PE=3 SV=1 755 1097 7.0E-34
sp|Q65PB5|RPOB_BACLD DNA-directed RNA polymerase subunit beta OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpoB PE=3 SV=1 755 1097 9.0E-34
sp|P37870|RPOB_BACSU DNA-directed RNA polymerase subunit beta OS=Bacillus subtilis (strain 168) GN=rpoB PE=1 SV=2 755 1097 1.0E-33
sp|A8F976|RPOB_BACP2 DNA-directed RNA polymerase subunit beta OS=Bacillus pumilus (strain SAFR-032) GN=rpoB PE=3 SV=1 755 1097 1.0E-33
sp|A7Z0M9|RPOB_BACMF DNA-directed RNA polymerase subunit beta OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpoB PE=3 SV=1 755 1097 1.0E-33
sp|Q1ACN6|RPOB_CHAVU DNA-directed RNA polymerase subunit beta OS=Chara vulgaris GN=rpoB PE=3 SV=2 755 1119 2.0E-33
sp|Q7NIA0|RPOB_GLOVI DNA-directed RNA polymerase subunit beta OS=Gloeobacter violaceus (strain PCC 7421) GN=rpoB PE=3 SV=1 755 1097 2.0E-33
sp|B9DKV0|RPOB_STACT DNA-directed RNA polymerase subunit beta OS=Staphylococcus carnosus (strain TM300) GN=rpoB PE=3 SV=1 755 1169 2.0E-33
sp|B1VAM6|RPOB_PHYAS DNA-directed RNA polymerase subunit beta OS=Phytoplasma australiense GN=rpoB PE=3 SV=1 672 1097 2.0E-33
sp|Q67JT3|RPOB_SYMTH DNA-directed RNA polymerase subunit beta OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rpoB PE=3 SV=1 672 1097 2.0E-33
sp|B0KCJ2|RPOB_THEP3 DNA-directed RNA polymerase subunit beta OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpoB PE=3 SV=1 755 1097 3.0E-33
sp|P77965|RPOB_SYNY3 DNA-directed RNA polymerase subunit beta OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rpoB PE=3 SV=1 755 1101 3.0E-33
sp|Q8RHI6|RPOB_FUSNN DNA-directed RNA polymerase subunit beta OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rpoB PE=3 SV=1 755 1097 3.0E-33
sp|Q661M9|RPOB_BORBP DNA-directed RNA polymerase subunit beta OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rpoB PE=3 SV=1 762 1127 3.0E-33
sp|Q034X0|RPOB_LACC3 DNA-directed RNA polymerase subunit beta OS=Lactobacillus casei (strain ATCC 334) GN=rpoB PE=3 SV=1 755 1097 3.0E-33
sp|Q3A9Q7|RPOB_CARHZ DNA-directed RNA polymerase subunit beta OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpoB PE=3 SV=1 755 1097 3.0E-33
sp|B3WAM8|RPOB_LACCB DNA-directed RNA polymerase subunit beta OS=Lactobacillus casei (strain BL23) GN=rpoB PE=3 SV=1 755 1097 3.0E-33
sp|Q82Z40|RPOB_ENTFA DNA-directed RNA polymerase subunit beta OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpoB PE=3 SV=1 755 1097 4.0E-33
sp|A4IJI1|RPOB_GEOTN DNA-directed RNA polymerase subunit beta OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpoB PE=3 SV=1 755 1097 4.0E-33
sp|B0K5G8|RPOB_THEPX DNA-directed RNA polymerase subunit beta OS=Thermoanaerobacter sp. (strain X514) GN=rpoB PE=3 SV=1 755 1097 4.0E-33
sp|Q5L405|RPOB_GEOKA DNA-directed RNA polymerase subunit beta OS=Geobacillus kaustophilus (strain HTA426) GN=rpoB PE=3 SV=1 755 1097 4.0E-33
sp|B3E163|RPOB_METI4 DNA-directed RNA polymerase subunit beta OS=Methylacidiphilum infernorum (isolate V4) GN=rpoB PE=3 SV=1 870 1127 4.0E-33
sp|A8AZI3|RPOB_STRGC DNA-directed RNA polymerase subunit beta OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpoB PE=3 SV=1 755 1122 5.0E-33
sp|B9DSZ5|RPOB_STRU0 DNA-directed RNA polymerase subunit beta OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpoB PE=3 SV=1 755 1097 5.0E-33
sp|Q85X54|RPOB_PINKO DNA-directed RNA polymerase subunit beta OS=Pinus koraiensis GN=rpoB PE=3 SV=1 755 1119 5.0E-33
sp|A1BD23|RPOB_CHLPD DNA-directed RNA polymerase subunit beta OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rpoB PE=3 SV=1 893 1097 5.0E-33
sp|Q8GCR6|RPOB1_ENTFC DNA-directed RNA polymerase subunit beta OS=Enterococcus faecium GN=rpoB PE=3 SV=1 755 1122 5.0E-33
sp|P49466|RPOB_ODOSI DNA-directed RNA polymerase subunit beta OS=Odontella sinensis GN=rpoB PE=3 SV=1 755 1101 5.0E-33
sp|Q4A5S7|RPOB_MYCS5 DNA-directed RNA polymerase subunit beta OS=Mycoplasma synoviae (strain 53) GN=rpoB PE=3 SV=2 471 1129 5.0E-33
sp|Q8GCR4|RPOB2_ENTFC DNA-directed RNA polymerase subunit beta OS=Enterococcus faecium GN=rpoB PE=3 SV=1 755 1097 5.0E-33
sp|Q8GCR5|RPOB3_ENTFC DNA-directed RNA polymerase subunit beta OS=Enterococcus faecium GN=rpoB PE=3 SV=1 755 1097 6.0E-33
sp|A9NEL7|RPOB_ACHLI DNA-directed RNA polymerase subunit beta OS=Acholeplasma laidlawii (strain PG-8A) GN=rpoB PE=3 SV=1 755 1097 6.0E-33
sp|B0SAG1|RPOB_LEPBA DNA-directed RNA polymerase subunit beta OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=rpoB PE=3 SV=1 755 1156 7.0E-33
sp|B0SSI4|RPOB_LEPBP DNA-directed RNA polymerase subunit beta OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=rpoB PE=3 SV=1 755 1156 7.0E-33
sp|Q9KK59|RPOB_LEPBI DNA-directed RNA polymerase subunit beta OS=Leptospira biflexa GN=rpoB PE=3 SV=1 755 1156 7.0E-33
sp|Q4L3K3|RPOB_STAHJ DNA-directed RNA polymerase subunit beta OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpoB PE=3 SV=1 755 1097 7.0E-33
sp|P48119|RPOB_CYAPA DNA-directed RNA polymerase subunit beta OS=Cyanophora paradoxa GN=rpoB PE=3 SV=1 755 1097 8.0E-33
sp|Q59191|RPOB_BORBU DNA-directed RNA polymerase subunit beta OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rpoB PE=3 SV=2 762 1127 9.0E-33
sp|A5IQ96|RPOB_STAA9 DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain JH9) GN=rpoB PE=3 SV=1 755 1097 9.0E-33
sp|B9LL91|RPOB_CHLSY DNA-directed RNA polymerase subunit beta OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=rpoB PE=3 SV=1 755 1097 9.0E-33
sp|A9WH12|RPOB_CHLAA DNA-directed RNA polymerase subunit beta OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=rpoB PE=3 SV=1 755 1097 9.0E-33
sp|Q932F8|RPOB_STAAM DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpoB PE=3 SV=1 755 1097 1.0E-32
sp|P60279|RPOB_STAAW DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain MW2) GN=rpoB PE=3 SV=1 755 1097 1.0E-32
sp|A8YZP0|RPOB_STAAT DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rpoB PE=3 SV=1 755 1097 1.0E-32
sp|Q6GBU5|RPOB_STAAS DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain MSSA476) GN=rpoB PE=3 SV=1 755 1097 1.0E-32
sp|Q6GJC6|RPOB_STAAR DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain MRSA252) GN=rpoB PE=3 SV=1 755 1097 1.0E-32
sp|P60278|RPOB_STAAN DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain N315) GN=rpoB PE=1 SV=1 755 1097 1.0E-32
sp|A6QEJ4|RPOB_STAAE DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain Newman) GN=rpoB PE=3 SV=1 755 1097 1.0E-32
sp|Q2YSB9|RPOB_STAAB DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpoB PE=3 SV=1 755 1097 1.0E-32
sp|P47768|RPOB_STAA8 DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain NCTC 8325) GN=rpoB PE=3 SV=2 755 1097 1.0E-32
sp|Q2FJ98|RPOB_STAA3 DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain USA300) GN=rpoB PE=3 SV=2 755 1097 1.0E-32
sp|A6TZ19|RPOB_STAA2 DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain JH1) GN=rpoB PE=3 SV=1 755 1097 1.0E-32
sp|A7WYW7|RPOB_STAA1 DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rpoB PE=3 SV=1 755 1097 1.0E-32
sp|B7J1W1|RPOB_BORBZ DNA-directed RNA polymerase subunit beta OS=Borrelia burgdorferi (strain ZS7) GN=rpoB PE=3 SV=1 762 1127 1.0E-32
sp|Q8GCR3|RPOB4_ENTFC DNA-directed RNA polymerase subunit beta OS=Enterococcus faecium GN=rpoB PE=3 SV=1 755 1097 1.0E-32
sp|Q8CQ84|RPOB_STAES DNA-directed RNA polymerase subunit beta OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpoB PE=3 SV=1 755 1097 1.0E-32
sp|Q5HRL0|RPOB_STAEQ DNA-directed RNA polymerase subunit beta OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpoB PE=3 SV=1 755 1097 1.0E-32
sp|Q98Q23|RPOB_MYCPU DNA-directed RNA polymerase subunit beta OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rpoB PE=3 SV=1 719 1101 1.0E-32
sp|B9E8Q5|RPOB_MACCJ DNA-directed RNA polymerase subunit beta OS=Macrococcus caseolyticus (strain JCSC5402) GN=rpoB PE=3 SV=1 755 1097 1.0E-32
sp|B3QZH0|RPOB_PHYMT DNA-directed RNA polymerase subunit beta OS=Phytoplasma mali (strain AT) GN=rpoB PE=3 SV=1 755 1097 1.0E-32
sp|A4VSK2|RPOB_STRSY DNA-directed RNA polymerase subunit beta OS=Streptococcus suis (strain 05ZYH33) GN=rpoB PE=3 SV=1 755 1097 1.0E-32
sp|A4VYU3|RPOB_STRS2 DNA-directed RNA polymerase subunit beta OS=Streptococcus suis (strain 98HAH33) GN=rpoB PE=3 SV=1 755 1097 1.0E-32
sp|A6TWJ0|RPOB_ALKMQ DNA-directed RNA polymerase subunit beta OS=Alkaliphilus metalliredigens (strain QYMF) GN=rpoB PE=3 SV=1 755 1146 2.0E-32
sp|Q19V98|RPOB_CHLAT DNA-directed RNA polymerase subunit beta OS=Chlorokybus atmophyticus GN=rpoB PE=3 SV=2 755 1097 2.0E-32
sp|A3CKD3|RPOB_STRSV DNA-directed RNA polymerase subunit beta OS=Streptococcus sanguinis (strain SK36) GN=rpoB PE=3 SV=2 755 1122 2.0E-32
sp|Q8DS46|RPOB_STRMU DNA-directed RNA polymerase subunit beta OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpoB PE=3 SV=1 755 1097 2.0E-32
sp|Q93GF2|RPOB_TROWT DNA-directed RNA polymerase subunit beta OS=Tropheryma whipplei (strain Twist) GN=rpoB PE=3 SV=2 471 1158 2.0E-32
sp|P59642|RPOB_TROW8 DNA-directed RNA polymerase subunit beta OS=Tropheryma whipplei (strain TW08/27) GN=rpoB PE=3 SV=1 471 1158 2.0E-32
sp|Q0SNB8|RPOB_BORAP DNA-directed RNA polymerase subunit beta OS=Borrelia afzelii (strain PKo) GN=rpoB PE=3 SV=1 762 1127 2.0E-32
sp|Q38UQ2|RPOB_LACSS DNA-directed RNA polymerase subunit beta OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpoB PE=3 SV=1 755 1097 2.0E-32
sp|Q9A1U1|RPOB_STRP1 DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M1 GN=rpoB PE=3 SV=1 755 1097 2.0E-32
sp|A4J103|RPOB_DESRM DNA-directed RNA polymerase subunit beta OS=Desulfotomaculum reducens (strain MI-1) GN=rpoB PE=3 SV=1 755 1097 2.0E-32
sp|B5XJ72|RPOB_STRPZ DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=rpoB PE=3 SV=1 755 1097 2.0E-32
sp|P0DF31|RPOB_STRPQ DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rpoB PE=3 SV=1 755 1097 2.0E-32
sp|Q48VR1|RPOB_STRPM DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rpoB PE=3 SV=1 755 1097 2.0E-32
sp|A2RC51|RPOB_STRPG DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rpoB PE=3 SV=1 755 1097 2.0E-32
sp|Q1J8X1|RPOB_STRPF DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rpoB PE=3 SV=1 755 1097 2.0E-32
sp|Q1JJ23|RPOB_STRPD DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rpoB PE=3 SV=1 755 1097 2.0E-32
sp|Q1JE20|RPOB_STRPB DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rpoB PE=3 SV=1 755 1097 2.0E-32
sp|Q8P2Y3|RPOB_STRP8 DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rpoB PE=3 SV=1 755 1097 2.0E-32
sp|Q5XE97|RPOB_STRP6 DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rpoB PE=3 SV=1 755 1097 2.0E-32
sp|P0DF30|RPOB_STRP3 DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rpoB PE=3 SV=1 755 1097 2.0E-32
sp|Q2JJ19|RPOB_SYNJB DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=rpoB PE=3 SV=1 755 1097 3.0E-32
sp|Q8E239|RPOB_STRA5 DNA-directed RNA polymerase subunit beta OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rpoB PE=3 SV=1 755 1097 3.0E-32
sp|Q8E7J8|RPOB_STRA3 DNA-directed RNA polymerase subunit beta OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rpoB PE=3 SV=1 755 1097 3.0E-32
sp|Q3K3L2|RPOB_STRA1 DNA-directed RNA polymerase subunit beta OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rpoB PE=3 SV=1 755 1097 3.0E-32
sp|B8G4U9|RPOB_CHLAD DNA-directed RNA polymerase subunit beta OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rpoB PE=3 SV=1 755 1097 3.0E-32
sp|P0C2E7|RPOB_CLOPE DNA-directed RNA polymerase subunit beta OS=Clostridium perfringens (strain 13 / Type A) GN=rpoB PE=3 SV=1 755 1097 3.0E-32
sp|Q0TMN8|RPOB_CLOP1 DNA-directed RNA polymerase subunit beta OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rpoB PE=3 SV=1 755 1097 3.0E-32
sp|Q0SQD6|RPOB_CLOPS DNA-directed RNA polymerase subunit beta OS=Clostridium perfringens (strain SM101 / Type A) GN=rpoB PE=3 SV=1 755 1097 3.0E-32
sp|Q8R7U6|RPOB_CALS4 DNA-directed RNA polymerase subunit beta OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpoB PE=3 SV=1 755 1097 3.0E-32
sp|C0MEE3|RPOB_STRS7 DNA-directed RNA polymerase subunit beta OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpoB PE=3 SV=1 755 1122 3.0E-32
sp|Q7URW6|RPOB_RHOBA DNA-directed RNA polymerase subunit beta OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=rpoB PE=3 SV=2 897 1129 3.0E-32
sp|B4U047|RPOB_STREM DNA-directed RNA polymerase subunit beta OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=rpoB PE=3 SV=1 755 1122 3.0E-32
sp|C0M7C8|RPOB_STRE4 DNA-directed RNA polymerase subunit beta OS=Streptococcus equi subsp. equi (strain 4047) GN=rpoB PE=3 SV=1 755 1122 3.0E-32
sp|C1CGP4|RPOB_STRZJ DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae (strain JJA) GN=rpoB PE=3 SV=1 755 1122 3.0E-32
sp|Q97NQ7|RPOB_STRPN DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpoB PE=3 SV=1 755 1122 3.0E-32
sp|Q0AUH2|RPOB_SYNWW DNA-directed RNA polymerase subunit beta OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rpoB PE=3 SV=1 755 1147 4.0E-32
sp|B8ZNW7|RPOB_STRPJ DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpoB PE=3 SV=1 755 1122 4.0E-32
sp|B5E2F3|RPOB_STRP4 DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpoB PE=3 SV=1 755 1122 4.0E-32
sp|C1CA06|RPOB_STRP7 DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae (strain 70585) GN=rpoB PE=3 SV=1 755 1122 4.0E-32
sp|C1CTL4|RPOB_STRZT DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpoB PE=3 SV=1 755 1122 4.0E-32
sp|C1CMQ8|RPOB_STRZP DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae (strain P1031) GN=rpoB PE=3 SV=1 755 1122 4.0E-32
sp|Q8DNF0|RPOB_STRR6 DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpoB PE=3 SV=2 755 1122 4.0E-32
sp|Q04IK6|RPOB_STRP2 DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpoB PE=3 SV=1 755 1122 4.0E-32
sp|B1I8R4|RPOB_STRPI DNA-directed RNA polymerase subunit beta OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpoB PE=3 SV=1 755 1122 4.0E-32
sp|Q8ETY8|RPOB_OCEIH DNA-directed RNA polymerase subunit beta OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpoB PE=3 SV=1 755 1097 5.0E-32
sp|Q09G54|RPOB_PLAOC DNA-directed RNA polymerase subunit beta OS=Platanus occidentalis GN=rpoB PE=3 SV=1 755 1101 5.0E-32
sp|Q5HID3|RPOB_STAAC DNA-directed RNA polymerase subunit beta OS=Staphylococcus aureus (strain COL) GN=rpoB PE=3 SV=1 755 1097 5.0E-32
sp|B1IGG2|RPOB_CLOBK DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain Okra / Type B1) GN=rpoB PE=3 SV=1 755 1097 5.0E-32
sp|A5I7L4|RPOB_CLOBH DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rpoB PE=3 SV=1 755 1097 6.0E-32
sp|A7FZ77|RPOB_CLOB1 DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rpoB PE=3 SV=1 755 1097 6.0E-32
sp|P41607|RPOB_PINTH DNA-directed RNA polymerase subunit beta OS=Pinus thunbergii GN=rpoB PE=3 SV=1 755 1119 7.0E-32
sp|A0T0R1|RPOB_THAPS DNA-directed RNA polymerase subunit beta OS=Thalassiosira pseudonana GN=rpoB PE=3 SV=1 755 1127 7.0E-32
sp|Q81J48|RPOB_BACCR DNA-directed RNA polymerase subunit beta OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rpoB PE=3 SV=1 755 1097 7.0E-32
sp|B7HJ40|RPOB_BACC4 DNA-directed RNA polymerase subunit beta OS=Bacillus cereus (strain B4264) GN=rpoB PE=3 SV=1 755 1097 7.0E-32
sp|B7IT11|RPOB_BACC2 DNA-directed RNA polymerase subunit beta OS=Bacillus cereus (strain G9842) GN=rpoB PE=3 SV=1 755 1097 7.0E-32
sp|P59643|RPOB_TROWH DNA-directed RNA polymerase subunit beta OS=Tropheryma whipplei GN=rpoB PE=3 SV=1 471 1158 7.0E-32
sp|C1FMV9|RPOB_CLOBJ DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain Kyoto / Type A2) GN=rpoB PE=3 SV=1 755 1097 7.0E-32
sp|A7GJ82|RPOB_CLOBL DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rpoB PE=3 SV=1 755 1097 7.0E-32
sp|Q6HPR6|RPOB_BACHK DNA-directed RNA polymerase subunit beta OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rpoB PE=3 SV=1 755 1097 7.0E-32
sp|Q63H98|RPOB_BACCZ DNA-directed RNA polymerase subunit beta OS=Bacillus cereus (strain ZK / E33L) GN=rpoB PE=3 SV=1 755 1097 7.0E-32
sp|B9IZI6|RPOB_BACCQ DNA-directed RNA polymerase subunit beta OS=Bacillus cereus (strain Q1) GN=rpoB PE=3 SV=1 755 1097 7.0E-32
sp|B7HQT6|RPOB_BACC7 DNA-directed RNA polymerase subunit beta OS=Bacillus cereus (strain AH187) GN=rpoB PE=3 SV=1 755 1097 7.0E-32
sp|C1ET31|RPOB_BACC3 DNA-directed RNA polymerase subunit beta OS=Bacillus cereus (strain 03BB102) GN=rpoB PE=3 SV=1 755 1097 7.0E-32
sp|Q73FA4|RPOB_BACC1 DNA-directed RNA polymerase subunit beta OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rpoB PE=3 SV=1 755 1097 7.0E-32
sp|A0R8H2|RPOB_BACAH DNA-directed RNA polymerase subunit beta OS=Bacillus thuringiensis (strain Al Hakam) GN=rpoB PE=3 SV=2 755 1097 7.0E-32
sp|C3KVQ9|RPOB_CLOB6 DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain 657 / Type Ba4) GN=rpoB PE=3 SV=1 755 1097 7.0E-32
sp|Q81VT8|RPOB_BACAN DNA-directed RNA polymerase subunit beta OS=Bacillus anthracis GN=rpoB PE=3 SV=1 755 1097 8.0E-32
sp|C3LJ74|RPOB_BACAC DNA-directed RNA polymerase subunit beta OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rpoB PE=3 SV=1 755 1097 8.0E-32
sp|C3P9P7|RPOB_BACAA DNA-directed RNA polymerase subunit beta OS=Bacillus anthracis (strain A0248) GN=rpoB PE=3 SV=1 755 1097 8.0E-32
sp|Q6YQW3|RPOB_ONYPE DNA-directed RNA polymerase subunit beta OS=Onion yellows phytoplasma (strain OY-M) GN=rpoB PE=3 SV=1 755 1097 8.0E-32
sp|B1KSN3|RPOB_CLOBM DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rpoB PE=3 SV=1 755 1097 8.0E-32
sp|B2UYA3|RPOB_CLOBA DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rpoB PE=3 SV=1 755 1097 9.0E-32
sp|B2TIG8|RPOB_CLOBB DNA-directed RNA polymerase subunit beta OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rpoB PE=3 SV=1 755 1097 9.0E-32
sp|A0AF63|RPOB_LISW6 DNA-directed RNA polymerase subunit beta OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpoB PE=3 SV=1 755 1097 1.0E-31
sp|P23579|RPOB_EUGGR DNA-directed RNA polymerase subunit beta OS=Euglena gracilis GN=rpoB PE=3 SV=1 755 1117 1.0E-31
sp|Q8F0S2|RPOB_LEPIN DNA-directed RNA polymerase subunit beta OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=rpoB PE=3 SV=1 755 1127 1.0E-31
sp|Q92F22|RPOB_LISIN DNA-directed RNA polymerase subunit beta OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpoB PE=3 SV=1 755 1097 1.0E-31
sp|Q9RLT9|RPOB_LISMO DNA-directed RNA polymerase subunit beta OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpoB PE=3 SV=1 755 1097 1.0E-31
sp|Q724F0|RPOB_LISMF DNA-directed RNA polymerase subunit beta OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpoB PE=3 SV=1 755 1097 1.0E-31
sp|C1KYJ3|RPOB_LISMC DNA-directed RNA polymerase subunit beta OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rpoB PE=3 SV=1 755 1097 1.0E-31
sp|B8DEY8|RPOB_LISMH DNA-directed RNA polymerase subunit beta OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rpoB PE=3 SV=1 755 1097 1.0E-31
sp|Q72UA8|RPOB_LEPIC DNA-directed RNA polymerase subunit beta OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=rpoB PE=3 SV=1 755 1127 1.0E-31
sp|Q054E2|RPOB_LEPBL DNA-directed RNA polymerase subunit beta OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=rpoB PE=3 SV=1 755 1127 1.0E-31
sp|Q04QI9|RPOB_LEPBJ DNA-directed RNA polymerase subunit beta OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=rpoB PE=3 SV=1 755 1127 1.0E-31
sp|Q02X59|RPOB_LACLS DNA-directed RNA polymerase subunit beta OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rpoB PE=3 SV=1 755 1097 1.0E-31
sp|Q2NJ15|RPOB_AYWBP DNA-directed RNA polymerase subunit beta OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=rpoB PE=3 SV=1 755 1097 1.0E-31
sp|A2RML9|RPOB_LACLM DNA-directed RNA polymerase subunit beta OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rpoB PE=3 SV=1 755 1097 1.0E-31
sp|Q9RVV9|RPOB_DEIRA DNA-directed RNA polymerase subunit beta OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rpoB PE=3 SV=2 755 1097 1.0E-31
sp|Q8KG15|RPOB_CHLTE DNA-directed RNA polymerase subunit beta OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=rpoB PE=3 SV=1 893 1097 1.0E-31
sp|Q6B8R8|RPOB_GRATL DNA-directed RNA polymerase subunit beta OS=Gracilaria tenuistipitata var. liui GN=rpoB PE=3 SV=1 755 1101 1.0E-31
sp|O83269|RPOB_TREPA DNA-directed RNA polymerase subunit beta OS=Treponema pallidum (strain Nichols) GN=rpoB PE=3 SV=1 755 1097 2.0E-31
sp|Q9CEN6|RPOB_LACLA DNA-directed RNA polymerase subunit beta OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rpoB PE=3 SV=1 755 1097 2.0E-31
sp|Q2S1Q5|RPOB_SALRD DNA-directed RNA polymerase subunit beta OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rpoB PE=3 SV=2 868 1127 2.0E-31
sp|A8LC64|RPOB_FRASN DNA-directed RNA polymerase subunit beta OS=Frankia sp. (strain EAN1pec) GN=rpoB PE=3 SV=1 672 1097 2.0E-31
sp|Q6MRX6|RPOB_MYCMS DNA-directed RNA polymerase subunit beta OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=rpoB PE=3 SV=1 755 1097 2.0E-31
sp|Q97EG9|RPOB_CLOAB DNA-directed RNA polymerase subunit beta OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpoB PE=3 SV=1 755 1097 2.0E-31
sp|Q2JFI5|RPOB_FRASC DNA-directed RNA polymerase subunit beta OS=Frankia sp. (strain CcI3) GN=rpoB PE=3 SV=1 672 1097 2.0E-31
sp|Q56P13|RPOB_LACSA DNA-directed RNA polymerase subunit beta OS=Lactuca sativa GN=rpoB PE=3 SV=2 755 1101 2.0E-31
sp|Q09MI6|RPOB_CITSI DNA-directed RNA polymerase subunit beta OS=Citrus sinensis GN=rpoB PE=3 SV=1 755 1101 2.0E-31
sp|Q49L06|RPOB_EUCGG DNA-directed RNA polymerase subunit beta OS=Eucalyptus globulus subsp. globulus GN=rpoB PE=3 SV=1 755 1101 2.0E-31
sp|Q9KWU7|RPOB_THEAQ DNA-directed RNA polymerase subunit beta OS=Thermus aquaticus GN=rpoB PE=1 SV=1 755 1097 3.0E-31
sp|Q85FM7|RPOB_ADICA DNA-directed RNA polymerase subunit beta OS=Adiantum capillus-veneris GN=rpoB PE=2 SV=2 755 1119 3.0E-31
sp|Q32RG0|RPOB_ZYGCR DNA-directed RNA polymerase subunit beta OS=Zygnema circumcarinatum GN=rpoB PE=3 SV=1 507 1101 3.0E-31
sp|A0PXT8|RPOB_CLONN DNA-directed RNA polymerase subunit beta OS=Clostridium novyi (strain NT) GN=rpoB PE=3 SV=1 749 1097 3.0E-31
sp|Q7VA29|RPOB_PROMA DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rpoB PE=3 SV=1 755 1127 4.0E-31
sp|Q3B1H7|RPOB_CHLL7 DNA-directed RNA polymerase subunit beta OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rpoB PE=3 SV=1 893 1097 4.0E-31
sp|Q73JJ7|RPOB_TREDE DNA-directed RNA polymerase subunit beta OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rpoB PE=3 SV=1 755 1127 4.0E-31
sp|Q03IK2|RPOB_STRTD DNA-directed RNA polymerase subunit beta OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpoB PE=3 SV=1 755 1122 5.0E-31
sp|Q8RQE9|RPOB_THET8 DNA-directed RNA polymerase subunit beta OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpoB PE=1 SV=1 755 1097 5.0E-31
sp|Q5M2F5|RPOB_STRT2 DNA-directed RNA polymerase subunit beta OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpoB PE=3 SV=1 755 1122 5.0E-31
sp|Q5LXV3|RPOB_STRT1 DNA-directed RNA polymerase subunit beta OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpoB PE=3 SV=1 755 1122 5.0E-31
sp|Q72HM5|RPOB_THET2 DNA-directed RNA polymerase subunit beta OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpoB PE=3 SV=1 755 1097 5.0E-31
sp|Q5SCX8|RPOB_HUPLU DNA-directed RNA polymerase subunit beta OS=Huperzia lucidula GN=rpoB PE=3 SV=1 754 1133 5.0E-31
sp|A4QLS5|RPOB_NASOF DNA-directed RNA polymerase subunit beta OS=Nasturtium officinale GN=rpoB PE=3 SV=1 755 1101 5.0E-31
sp|Q0RRT0|RPOB_FRAAA DNA-directed RNA polymerase subunit beta OS=Frankia alni (strain ACN14a) GN=rpoB PE=3 SV=1 755 1097 6.0E-31
sp|Q1J0P6|RPOB_DEIGD DNA-directed RNA polymerase subunit beta OS=Deinococcus geothermalis (strain DSM 11300) GN=rpoB PE=3 SV=1 755 1097 6.0E-31
sp|Q1KXX2|RPOB_HELAN DNA-directed RNA polymerase subunit beta OS=Helianthus annuus GN=rpoB PE=3 SV=1 755 1101 6.0E-31
sp|Q2ST48|RPOB_MYCCT DNA-directed RNA polymerase subunit beta OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rpoB PE=3 SV=1 755 1097 6.0E-31
sp|Q6L3A7|RPOB_SACHY DNA-directed RNA polymerase subunit beta OS=Saccharum hybrid GN=rpoB PE=2 SV=2 755 1098 6.0E-31
sp|Q09FW9|RPOB_NANDO DNA-directed RNA polymerase subunit beta OS=Nandina domestica GN=rpoB PE=3 SV=1 755 1101 6.0E-31
sp|P16023|RPOB_MAIZE DNA-directed RNA polymerase subunit beta OS=Zea mays GN=rpoB PE=3 SV=1 755 1098 6.0E-31
sp|Q6ENX3|RPOB_SACOF DNA-directed RNA polymerase subunit beta OS=Saccharum officinarum GN=rpoB PE=3 SV=1 755 1098 7.0E-31
sp|A4FPP3|RPOB_SACEN DNA-directed RNA polymerase subunit beta OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=rpoB PE=3 SV=1 672 1152 7.0E-31
sp|Q890N4|RPOB_CLOTE DNA-directed RNA polymerase subunit beta OS=Clostridium tetani (strain Massachusetts / E88) GN=rpoB PE=3 SV=1 755 1097 7.0E-31
sp|A1E9R4|RPOB_SORBI DNA-directed RNA polymerase subunit beta OS=Sorghum bicolor GN=rpoB PE=3 SV=1 755 1098 7.0E-31
sp|P56299|RPOB_CHLVU DNA-directed RNA polymerase subunit beta OS=Chlorella vulgaris GN=rpoB PE=3 SV=1 755 1097 7.0E-31
sp|P46818|RPOB_SINAL DNA-directed RNA polymerase subunit beta OS=Sinapis alba GN=rpoB PE=1 SV=2 755 1101 8.0E-31
sp|P51252|RPOB_PORPU DNA-directed RNA polymerase subunit beta OS=Porphyra purpurea GN=rpoB PE=3 SV=1 755 1127 9.0E-31
sp|A4QL11|RPOB_DRANE DNA-directed RNA polymerase subunit beta OS=Draba nemorosa GN=rpoB PE=3 SV=1 755 1101 9.0E-31
sp|P50546|RPOB_ARATH DNA-directed RNA polymerase subunit beta OS=Arabidopsis thaliana GN=rpoB PE=3 SV=4 755 1101 9.0E-31
sp|A3PEX4|RPOB_PROM0 DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain MIT 9301) GN=rpoB PE=3 SV=1 755 1127 1.0E-30
sp|A2C4N2|RPOB_PROM1 DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain NATL1A) GN=rpoB PE=3 SV=1 755 1127 1.0E-30
sp|A6LPQ4|RPOB_CLOB8 DNA-directed RNA polymerase subunit beta OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rpoB PE=3 SV=1 755 1174 1.0E-30
sp|A4QKI4|RPOB_CAPBU DNA-directed RNA polymerase subunit beta OS=Capsella bursa-pastoris GN=rpoB PE=3 SV=1 755 1101 1.0E-30
sp|A4QKS3|RPOB_CRUWA DNA-directed RNA polymerase subunit beta OS=Crucihimalaya wallichii GN=rpoB PE=3 SV=1 755 1101 1.0E-30
sp|A4QJJ1|RPOB_AETGR DNA-directed RNA polymerase subunit beta OS=Aethionema grandiflorum GN=rpoB PE=3 SV=1 755 1101 1.0E-30
sp|Q3ATP5|RPOB_CHLCH DNA-directed RNA polymerase subunit beta OS=Chlorobium chlorochromatii (strain CaD3) GN=rpoB PE=3 SV=1 893 1097 1.0E-30
sp|A4QK97|RPOB_BARVE DNA-directed RNA polymerase subunit beta OS=Barbarea verna GN=rpoB PE=3 SV=1 755 1101 1.0E-30
sp|A9BCH6|RPOB_PROM4 DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain MIT 9211) GN=rpoB PE=3 SV=1 755 1127 1.0E-30
sp|A4QL98|RPOB_LEPVR DNA-directed RNA polymerase subunit beta OS=Lepidium virginicum GN=rpoB PE=3 SV=1 755 1101 1.0E-30
sp|A4QJS5|RPOB_OLIPU DNA-directed RNA polymerase subunit beta OS=Olimarabidopsis pumila GN=rpoB PE=3 SV=1 755 1101 1.0E-30
sp|Q46J22|RPOB_PROMT DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain NATL2A) GN=rpoB PE=3 SV=1 755 1127 1.0E-30
sp|A5GVF3|RPOB_SYNR3 DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain RCC307) GN=rpoB PE=3 SV=2 755 1127 1.0E-30
sp|Q6A6K6|RPOB_PROAC DNA-directed RNA polymerase subunit beta OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=rpoB PE=3 SV=1 665 1097 1.0E-30
sp|Q589C0|RPOB_SILLA DNA-directed RNA polymerase subunit beta OS=Silene latifolia GN=rpoB PE=3 SV=1 755 1101 1.0E-30
sp|A2BT61|RPOB_PROMS DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain AS9601) GN=rpoB PE=3 SV=1 755 1127 2.0E-30
sp|Q0ZJ28|RPOB_VITVI DNA-directed RNA polymerase subunit beta OS=Vitis vinifera GN=rpoB PE=3 SV=1 755 1101 2.0E-30
sp|A4QK10|RPOB_ARAHI DNA-directed RNA polymerase subunit beta OS=Arabis hirsuta GN=rpoB PE=3 SV=1 755 1101 2.0E-30
sp|A4QLI6|RPOB_LOBMA DNA-directed RNA polymerase subunit beta OS=Lobularia maritima GN=rpoB PE=3 SV=1 755 1101 2.0E-30
sp|A8G6Y6|RPOB_PROM2 DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain MIT 9215) GN=rpoB PE=3 SV=1 755 1127 2.0E-30
sp|A1E9I1|RPOB_HORVU DNA-directed RNA polymerase subunit beta OS=Hordeum vulgare GN=rpoB PE=3 SV=1 755 1098 2.0E-30
sp|Q0I7L7|RPOB_SYNS3 DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain CC9311) GN=rpoB PE=3 SV=1 755 1127 2.0E-30
sp|A5GNH3|RPOB_SYNPW DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain WH7803) GN=rpoB PE=3 SV=1 755 1127 2.0E-30
sp|A4QJA7|RPOB_AETCO DNA-directed RNA polymerase subunit beta OS=Aethionema cordifolium GN=rpoB PE=3 SV=1 755 1101 2.0E-30
sp|A1SEK1|RPOB_NOCSJ DNA-directed RNA polymerase subunit beta OS=Nocardioides sp. (strain BAA-499 / JS614) GN=rpoB PE=3 SV=1 666 1097 2.0E-30
sp|Q47LI5|RPOB_THEFY DNA-directed RNA polymerase subunit beta OS=Thermobifida fusca (strain YX) GN=rpoB PE=3 SV=1 667 1097 2.0E-30
sp|A6MM28|RPOB_BUXMI DNA-directed RNA polymerase subunit beta OS=Buxus microphylla GN=rpoB PE=3 SV=1 755 1101 3.0E-30
sp|A5N4N9|RPOB_CLOK5 DNA-directed RNA polymerase subunit beta OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rpoB PE=3 SV=1 755 1097 3.0E-30
sp|B9DYA1|RPOB_CLOK1 DNA-directed RNA polymerase subunit beta OS=Clostridium kluyveri (strain NBRC 12016) GN=rpoB PE=3 SV=1 755 1097 3.0E-30
sp|Q318Q7|RPOB_PROM9 DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain MIT 9312) GN=rpoB PE=3 SV=1 755 1127 3.0E-30
sp|A6MVX4|RPOB_RHDSA DNA-directed RNA polymerase subunit beta OS=Rhodomonas salina GN=rpoB PE=3 SV=1 755 1127 3.0E-30
sp|Q7U8K4|RPOB_SYNPX DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain WH8102) GN=rpoB PE=3 SV=1 755 1127 3.0E-30
sp|Q01VB1|RPOB_SOLUE DNA-directed RNA polymerase subunit beta OS=Solibacter usitatus (strain Ellin6076) GN=rpoB PE=3 SV=2 897 1127 3.0E-30
sp|Q7V5P1|RPOB_PROMM DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain MIT 9313) GN=rpoB PE=3 SV=1 755 1127 3.0E-30
sp|A0ZZ27|RPOB_GOSBA DNA-directed RNA polymerase subunit beta OS=Gossypium barbadense GN=rpoB PE=3 SV=1 755 1101 3.0E-30
sp|A1E9Z8|RPOB_AGRST DNA-directed RNA polymerase subunit beta OS=Agrostis stolonifera GN=rpoB PE=3 SV=1 755 1098 3.0E-30
sp|Q9XPS7|RPOB_WHEAT DNA-directed RNA polymerase subunit beta OS=Triticum aestivum GN=rpoB PE=3 SV=1 755 1098 4.0E-30
sp|A6MMT6|RPOB_ILLOL DNA-directed RNA polymerase subunit beta OS=Illicium oligandrum GN=rpoB PE=3 SV=2 755 1101 4.0E-30
sp|Q0P3M6|RPOB_OSTTA DNA-directed RNA polymerase subunit beta OS=Ostreococcus tauri GN=rpoB PE=3 SV=1 755 1111 4.0E-30
sp|Q2L8Z9|RPOB_GOSHI DNA-directed RNA polymerase subunit beta OS=Gossypium hirsutum GN=rpoB PE=3 SV=1 755 1101 5.0E-30
sp|Q6MDM1|RPOB_PARUW DNA-directed RNA polymerase subunit beta OS=Protochlamydia amoebophila (strain UWE25) GN=rpoB PE=3 SV=1 844 1127 5.0E-30
sp|A2C6S8|RPOB_PROM3 DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain MIT 9303) GN=rpoB PE=3 SV=1 755 1127 5.0E-30
sp|Q1JNX8|RPOB_STRPC DNA-directed RNA polymerase subunit beta OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rpoB PE=3 SV=2 755 1097 6.0E-30
sp|A6MMB4|RPOB_CHLSC DNA-directed RNA polymerase subunit beta OS=Chloranthus spicatus GN=rpoB PE=3 SV=1 755 1101 6.0E-30
sp|A2BYL1|RPOB_PROM5 DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus (strain MIT 9515) GN=rpoB PE=3 SV=1 755 1122 6.0E-30
sp|A9L988|RPOB_LEMMI DNA-directed RNA polymerase subunit beta OS=Lemna minor GN=rpoB PE=3 SV=1 755 1101 7.0E-30
sp|Q7V006|RPOB_PROMP DNA-directed RNA polymerase subunit beta OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=rpoB PE=3 SV=1 755 1127 7.0E-30
sp|Q06RD9|RPOB_JASNU DNA-directed RNA polymerase subunit beta OS=Jasminum nudiflorum GN=rpoB PE=3 SV=1 755 1101 8.0E-30
sp|Q06GR8|RPOB_PIPCE DNA-directed RNA polymerase subunit beta OS=Piper cenocladum GN=rpoB PE=3 SV=1 755 1098 9.0E-30
sp|Q8HTL7|RPOB2_CHLRE DNA-directed RNA polymerase subunit beta C-terminal section OS=Chlamydomonas reinhardtii GN=rpoB2 PE=2 SV=1 755 1097 9.0E-30
sp|Q32RW5|RPOB_STAPU DNA-directed RNA polymerase subunit beta OS=Staurastrum punctulatum GN=rpoB PE=3 SV=1 755 1122 1.0E-29
sp|Q3AHX5|RPOB_SYNSC DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain CC9605) GN=rpoB PE=3 SV=1 755 1127 1.0E-29
sp|A7IKQ0|RPOB_XANP2 DNA-directed RNA polymerase subunit beta OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rpoB PE=3 SV=1 878 1127 1.0E-29
sp|Q2IXS0|RPOB_RHOP2 DNA-directed RNA polymerase subunit beta OS=Rhodopseudomonas palustris (strain HaA2) GN=rpoB PE=3 SV=1 856 1097 1.0E-29
sp|P0C503|RPOB_ORYSJ DNA-directed RNA polymerase subunit beta OS=Oryza sativa subsp. japonica GN=rpoB PE=3 SV=1 755 1098 1.0E-29
sp|P0C502|RPOB_ORYSI DNA-directed RNA polymerase subunit beta OS=Oryza sativa subsp. indica GN=rpoB PE=3 SV=1 755 1098 1.0E-29
sp|P0C501|RPOB_ORYSA DNA-directed RNA polymerase subunit beta OS=Oryza sativa GN=rpoB PE=3 SV=1 755 1098 1.0E-29
sp|Q6ENI4|RPOB_ORYNI DNA-directed RNA polymerase subunit beta OS=Oryza nivara GN=rpoB PE=3 SV=1 755 1098 1.0E-29
sp|Q20EX1|RPOB_OLTVI DNA-directed RNA polymerase subunit beta OS=Oltmannsiellopsis viridis GN=rpoB PE=3 SV=1 755 1097 1.0E-29
sp|B8IS78|RPOB_METNO DNA-directed RNA polymerase subunit beta OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rpoB PE=3 SV=1 851 1097 1.0E-29
sp|B0TC48|RPOB_HELMI DNA-directed RNA polymerase subunit beta OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rpoB PE=3 SV=1 755 1097 1.0E-29
sp|Q82DQ5|RPOB_STRAW DNA-directed RNA polymerase subunit beta OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=rpoB PE=3 SV=2 755 1097 1.0E-29
sp|Q3AZA4|RPOB_SYNS9 DNA-directed RNA polymerase subunit beta OS=Synechococcus sp. (strain CC9902) GN=rpoB PE=3 SV=1 755 1127 1.0E-29
sp|A8Z5T3|RPOB_SULMW DNA-directed RNA polymerase subunit beta OS=Sulcia muelleri (strain GWSS) GN=rpoB PE=3 SV=1 887 1097 1.0E-29
sp|Q09X25|RPOB_MORIN DNA-directed RNA polymerase subunit beta OS=Morus indica GN=rpoB PE=3 SV=1 755 1101 1.0E-29
sp|Q134R8|RPOB_RHOPS DNA-directed RNA polymerase subunit beta OS=Rhodopseudomonas palustris (strain BisB5) GN=rpoB PE=3 SV=1 856 1127 1.0E-29
sp|Q33C46|RPOB_NICTO DNA-directed RNA polymerase subunit beta OS=Nicotiana tomentosiformis GN=rpoB PE=3 SV=1 755 1101 2.0E-29
sp|Q7YJX8|RPOB_CALFG DNA-directed RNA polymerase subunit beta OS=Calycanthus floridus var. glaucus GN=rpoB PE=3 SV=1 755 1101 2.0E-29
sp|Q8A469|RPOB_BACTN DNA-directed RNA polymerase subunit beta OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rpoB PE=3 SV=1 888 1127 2.0E-29
sp|Q8S8X9|RPOB_ATRBE DNA-directed RNA polymerase subunit beta OS=Atropa belladonna GN=rpoB PE=3 SV=1 755 1101 2.0E-29
sp|Q6KI09|RPOB_MYCMO DNA-directed RNA polymerase subunit beta OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=rpoB PE=3 SV=1 755 1097 2.0E-29
sp|Q9TM35|RPOB_CYACA DNA-directed RNA polymerase subunit beta OS=Cyanidium caldarium GN=rpoB PE=3 SV=1 755 1101 2.0E-29
sp|Q9MTM5|RPOB_OENEH DNA-directed RNA polymerase subunit beta OS=Oenothera elata subsp. hookeri GN=rpoB PE=3 SV=2 755 1101 3.0E-29
sp|Q85BW1|RPOB_ANTFO DNA-directed RNA polymerase subunit beta OS=Anthoceros formosae GN=rpoB PE=2 SV=1 755 1101 3.0E-29
sp|Q68S14|RPOB_PANGI DNA-directed RNA polymerase subunit beta OS=Panax ginseng GN=rpoB PE=3 SV=1 755 1101 3.0E-29
sp|P60282|RPOB_AMBTC DNA-directed RNA polymerase subunit beta OS=Amborella trichopoda GN=rpoB PE=3 SV=2 755 1101 3.0E-29
sp|P06271|RPOB_TOBAC DNA-directed RNA polymerase subunit beta OS=Nicotiana tabacum GN=rpoB PE=3 SV=1 755 1101 3.0E-29
sp|Q3C1G7|RPOB_NICSY DNA-directed RNA polymerase subunit beta OS=Nicotiana sylvestris GN=rpoB PE=3 SV=1 755 1101 3.0E-29
sp|B3QC00|RPOB_RHOPT DNA-directed RNA polymerase subunit beta OS=Rhodopseudomonas palustris (strain TIE-1) GN=rpoB PE=3 SV=1 856 1127 4.0E-29
sp|Q6N4R9|RPOB_RHOPA DNA-directed RNA polymerase subunit beta OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rpoB PE=3 SV=1 856 1127 4.0E-29
sp|Q4A7A9|RPOB_MYCH7 DNA-directed RNA polymerase subunit beta OS=Mycoplasma hyopneumoniae (strain 7448) GN=rpoB PE=3 SV=1 755 1127 4.0E-29
sp|Q4A969|RPOB_MYCHJ DNA-directed RNA polymerase subunit beta OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=rpoB PE=3 SV=1 755 1127 4.0E-29
sp|Q06FW9|RPOB_PELHO DNA-directed RNA polymerase subunit beta OS=Pelargonium hortorum GN=rpoB PE=3 SV=1 755 1098 5.0E-29
sp|A6MMJ9|RPOB_DIOEL DNA-directed RNA polymerase subunit beta OS=Dioscorea elephantipes GN=rpoB PE=3 SV=1 755 1101 5.0E-29
sp|Q5ZZS1|RPOB_MYCH2 DNA-directed RNA polymerase subunit beta OS=Mycoplasma hyopneumoniae (strain 232) GN=rpoB PE=3 SV=1 755 1127 5.0E-29
sp|Q64NJ7|RPOB_BACFR DNA-directed RNA polymerase subunit beta OS=Bacteroides fragilis (strain YCH46) GN=rpoB PE=3 SV=1 888 1127 5.0E-29
sp|Q5L897|RPOB_BACFN DNA-directed RNA polymerase subunit beta OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rpoB PE=3 SV=1 888 1127 5.0E-29
sp|A8Y9G0|RPOB_LOLPR DNA-directed RNA polymerase subunit beta OS=Lolium perenne GN=rpoB PE=3 SV=1 755 1098 5.0E-29
sp|Q0G9X0|RPOB_DAUCA DNA-directed RNA polymerase subunit beta OS=Daucus carota GN=rpoB PE=3 SV=1 755 1101 6.0E-29
sp|Q6EW56|RPOB_NYMAL DNA-directed RNA polymerase subunit beta OS=Nymphaea alba GN=rpoB PE=3 SV=1 755 1101 6.0E-29
sp|Q4VZP1|RPOB_CUCSA DNA-directed RNA polymerase subunit beta OS=Cucumis sativus GN=rpoB PE=3 SV=2 755 1101 6.0E-29
sp|Q9F3X8|RPOB_PORCN DNA-directed RNA polymerase subunit beta OS=Porphyromonas cangingivalis GN=rpoB PE=3 SV=1 897 1127 6.0E-29
sp|Q2VEI4|RPOB_SOLTU DNA-directed RNA polymerase subunit beta OS=Solanum tuberosum GN=rpoB PE=3 SV=1 755 1101 6.0E-29
sp|A6KYK3|RPOB_BACV8 DNA-directed RNA polymerase subunit beta OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rpoB PE=3 SV=1 888 1127 6.0E-29
sp|Q8HVY5|RPOB_SOYBN DNA-directed RNA polymerase subunit beta OS=Glycine max GN=rpoB PE=3 SV=2 755 1098 6.0E-29
sp|A5USR7|RPOB_ROSS1 DNA-directed RNA polymerase subunit beta OS=Roseiflexus sp. (strain RS-1) GN=rpoB PE=3 SV=1 913 1097 6.0E-29
sp|Q4G3A7|RPOB_EMIHU DNA-directed RNA polymerase subunit beta OS=Emiliania huxleyi GN=rpoB PE=3 SV=1 755 1101 6.0E-29
sp|B1LY43|RPOB_METRJ DNA-directed RNA polymerase subunit beta OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rpoB PE=3 SV=1 851 1097 7.0E-29
sp|A7Y3B9|RPOB_IPOPU DNA-directed RNA polymerase subunit beta OS=Ipomoea purpurea GN=rpoB PE=3 SV=1 755 1101 7.0E-29
sp|B0UHX6|RPOB_METS4 DNA-directed RNA polymerase subunit beta OS=Methylobacterium sp. (strain 4-46) GN=rpoB PE=3 SV=1 851 1097 7.0E-29
sp|Q2MIJ5|RPOB_SOLBU DNA-directed RNA polymerase subunit beta OS=Solanum bulbocastanum GN=rpoB PE=3 SV=1 755 1101 8.0E-29
sp|Q2MIA8|RPOB_SOLLC DNA-directed RNA polymerase subunit beta OS=Solanum lycopersicum GN=rpoB PE=3 SV=1 755 1101 8.0E-29
sp|P11703|RPOB_SPIOL DNA-directed RNA polymerase subunit beta OS=Spinacia oleracea GN=rpoB PE=3 SV=1 755 1101 8.0E-29
sp|A4GYQ0|RPOB_POPTR DNA-directed RNA polymerase subunit beta OS=Populus trichocarpa GN=rpoB PE=3 SV=1 755 1101 9.0E-29
sp|A4YSI1|RPOB_BRASO DNA-directed RNA polymerase subunit beta OS=Bradyrhizobium sp. (strain ORS278) GN=rpoB PE=3 SV=1 856 1097 1.0E-28
sp|Q9TL06|RPOB_NEPOL DNA-directed RNA polymerase subunit beta OS=Nephroselmis olivacea GN=rpoB PE=3 SV=1 736 1101 1.0E-28
sp|A6LE81|RPOB_PARD8 DNA-directed RNA polymerase subunit beta OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rpoB PE=3 SV=1 888 1127 1.0E-28
sp|A8LM40|RPOB_DINSH DNA-directed RNA polymerase subunit beta OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rpoB PE=3 SV=1 897 1127 1.0E-28
sp|Q14FG5|RPOB_POPAL DNA-directed RNA polymerase subunit beta OS=Populus alba GN=rpoB PE=3 SV=1 755 1101 1.0E-28
sp|A6H5F9|RPOB_CYCTA DNA-directed RNA polymerase subunit beta OS=Cycas taitungensis GN=rpoB PE=3 SV=1 755 1119 1.0E-28
sp|Q06H05|RPOB_DRIGR DNA-directed RNA polymerase subunit beta OS=Drimys granadensis GN=rpoB PE=3 SV=1 755 1101 1.0E-28
sp|Q9Z9A0|RPOB_CHLPN DNA-directed RNA polymerase subunit beta OS=Chlamydia pneumoniae GN=rpoB PE=3 SV=1 897 1127 1.0E-28
sp|Q07KK7|RPOB_RHOP5 DNA-directed RNA polymerase subunit beta OS=Rhodopseudomonas palustris (strain BisA53) GN=rpoB PE=3 SV=1 856 1097 1.0E-28
sp|Q3ZJ93|RPOB_PSEAK DNA-directed RNA polymerase subunit beta OS=Pseudendoclonium akinetum GN=rpoB PE=3 SV=1 898 1116 1.0E-28
sp|A9W8N8|RPOB_METEP DNA-directed RNA polymerase subunit beta OS=Methylobacterium extorquens (strain PA1) GN=rpoB PE=3 SV=1 851 1097 2.0E-28
sp|B7KN45|RPOB_METC4 DNA-directed RNA polymerase subunit beta OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rpoB PE=3 SV=1 851 1097 2.0E-28
sp|A9ISG1|RPOB_BART1 DNA-directed RNA polymerase subunit beta OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rpoB PE=3 SV=1 851 1144 2.0E-28
sp|A9B6J3|RPOB_HERA2 DNA-directed RNA polymerase subunit beta OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=rpoB PE=3 SV=1 898 1097 2.0E-28
sp|Q9L0L0|RPOB_STRCO DNA-directed RNA polymerase subunit beta OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rpoB PE=1 SV=1 755 1097 2.0E-28
sp|B0BBU6|RPOB_CHLTB DNA-directed RNA polymerase subunit beta OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=rpoB PE=3 SV=1 897 1127 2.0E-28
sp|B0B7N1|RPOB_CHLT2 DNA-directed RNA polymerase subunit beta OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=rpoB PE=3 SV=1 897 1127 2.0E-28
sp|A4GGA5|RPOB_PHAVU DNA-directed RNA polymerase subunit beta OS=Phaseolus vulgaris GN=rpoB PE=3 SV=1 755 1098 2.0E-28
sp|Q3KM47|RPOB_CHLTA DNA-directed RNA polymerase subunit beta OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rpoB PE=3 SV=1 897 1127 2.0E-28
sp|Q211D8|RPOB_RHOPB DNA-directed RNA polymerase subunit beta OS=Rhodopseudomonas palustris (strain BisB18) GN=rpoB PE=3 SV=1 856 1097 2.0E-28
sp|P0CE09|RPOB_CHLTR DNA-directed RNA polymerase subunit beta OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rpoB PE=3 SV=1 897 1127 2.0E-28
sp|P56869|RPOB_CHLMU DNA-directed RNA polymerase subunit beta OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rpoB PE=3 SV=1 897 1127 2.0E-28
sp|Q822J1|RPOB_CHLCV DNA-directed RNA polymerase subunit beta OS=Chlamydophila caviae (strain GPIC) GN=rpoB PE=3 SV=1 657 1127 2.0E-28
sp|Q11HB3|RPOB_CHESB DNA-directed RNA polymerase subunit beta OS=Chelativorans sp. (strain BNC1) GN=rpoB PE=3 SV=1 851 1097 2.0E-28
sp|Q89J74|RPOB_BRADU DNA-directed RNA polymerase subunit beta OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rpoB PE=3 SV=1 856 1097 2.0E-28
sp|Q9KJG4|RPOB_BARHE DNA-directed RNA polymerase subunit beta OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpoB PE=3 SV=1 851 1144 3.0E-28
sp|Q255E6|RPOB_CHLFF DNA-directed RNA polymerase subunit beta OS=Chlamydophila felis (strain Fe/C-56) GN=rpoB PE=3 SV=1 897 1127 3.0E-28
sp|A0M3Y9|RPOB_GRAFK DNA-directed RNA polymerase subunit beta OS=Gramella forsetii (strain KT0803) GN=rpoB PE=3 SV=1 888 1127 3.0E-28
sp|Q3BAP8|RPOB_PHAAO DNA-directed RNA polymerase subunit beta OS=Phalaenopsis aphrodite subsp. formosana GN=rpoB PE=3 SV=2 755 1101 3.0E-28
sp|Q1QN44|RPOB_NITHX DNA-directed RNA polymerase subunit beta OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rpoB PE=3 SV=1 856 1097 3.0E-28
sp|B1ZGS0|RPOB_METPB DNA-directed RNA polymerase subunit beta OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rpoB PE=3 SV=1 851 1097 3.0E-28
sp|A5ELN7|RPOB_BRASB DNA-directed RNA polymerase subunit beta OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rpoB PE=3 SV=1 856 1097 3.0E-28
sp|C4LL71|RPOB_CORK4 DNA-directed RNA polymerase subunit beta OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=rpoB PE=3 SV=1 670 1142 3.0E-28
sp|Q28UX7|RPOB_JANSC DNA-directed RNA polymerase subunit beta OS=Jannaschia sp. (strain CCS1) GN=rpoB PE=3 SV=2 897 1127 3.0E-28
sp|Q5L5I3|RPOB_CHLAB DNA-directed RNA polymerase subunit beta OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=rpoB PE=3 SV=1 897 1097 4.0E-28
sp|Q9KJM5|RPOB_BARQU DNA-directed RNA polymerase subunit beta OS=Bartonella quintana (strain Toulouse) GN=rpoB PE=3 SV=2 851 1144 4.0E-28
sp|Q3SSY0|RPOB_NITWN DNA-directed RNA polymerase subunit beta OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rpoB PE=3 SV=1 856 1097 4.0E-28
sp|Q9BBS9|RPOB_LOTJA DNA-directed RNA polymerase subunit beta OS=Lotus japonicus GN=rpoB PE=3 SV=1 755 1101 4.0E-28
sp|Q0G9M7|RPOB_LIRTU DNA-directed RNA polymerase subunit beta OS=Liriodendron tulipifera GN=rpoB PE=3 SV=2 755 1101 4.0E-28
sp|Q3V542|RPOB_ACOCL DNA-directed RNA polymerase subunit beta OS=Acorus calamus GN=rpoB PE=3 SV=2 755 1101 4.0E-28
sp|A9LYH7|RPOB_ACOAM DNA-directed RNA polymerase subunit beta OS=Acorus americanus GN=rpoB PE=3 SV=1 755 1101 4.0E-28
sp|P9WGY9|RPOB_MYCTU DNA-directed RNA polymerase subunit beta OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rpoB PE=1 SV=1 649 1152 4.0E-28
sp|P9WGY8|RPOB_MYCTO DNA-directed RNA polymerase subunit beta OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rpoB PE=3 SV=1 649 1152 4.0E-28
sp|A1KGE7|RPOB_MYCBP DNA-directed RNA polymerase subunit beta OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=rpoB PE=3 SV=2 649 1152 4.0E-28
sp|P0A681|RPOB_MYCBO DNA-directed RNA polymerase subunit beta OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=rpoB PE=3 SV=1 649 1152 4.0E-28
sp|A0A327|RPOB_COFAR DNA-directed RNA polymerase subunit beta OS=Coffea arabica GN=rpoB PE=3 SV=1 755 1101 5.0E-28
sp|A5U052|RPOB_MYCTA DNA-directed RNA polymerase subunit beta OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=rpoB PE=3 SV=2 649 1152 5.0E-28
sp|Q5QA72|RPOB_ACOGR DNA-directed RNA polymerase subunit beta OS=Acorus gramineus GN=rpoB PE=3 SV=1 755 1101 5.0E-28
sp|Q8FS97|RPOB_COREF DNA-directed RNA polymerase subunit beta OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=rpoB PE=3 SV=1 471 1152 5.0E-28
sp|A1B015|RPOB_PARDP DNA-directed RNA polymerase subunit beta OS=Paracoccus denitrificans (strain Pd 1222) GN=rpoB PE=3 SV=1 897 1127 5.0E-28
sp|Q11QA5|RPOB_CYTH3 DNA-directed RNA polymerase subunit beta OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=rpoB PE=3 SV=1 888 1111 5.0E-28
sp|Q1GT23|RPOB_SPHAL DNA-directed RNA polymerase subunit beta OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rpoB PE=3 SV=1 838 1097 5.0E-28
sp|P06272|RPOB_MARPO DNA-directed RNA polymerase subunit beta OS=Marchantia polymorpha GN=rpoB PE=3 SV=1 755 1119 6.0E-28
sp|Q06J17|RPOB_BIGNA DNA-directed RNA polymerase subunit beta OS=Bigelowiella natans GN=rpoB PE=3 SV=1 755 1097 6.0E-28
sp|A8SE86|RPOB_CERDE DNA-directed RNA polymerase subunit beta OS=Ceratophyllum demersum GN=rpoB PE=3 SV=1 755 1101 6.0E-28
sp|A5GAY1|RPOB_GEOUR DNA-directed RNA polymerase subunit beta OS=Geobacter uraniireducens (strain Rf4) GN=rpoB PE=3 SV=1 897 1127 7.0E-28
sp|P36440|RPOB_HETAK DNA-directed RNA polymerase subunit beta OS=Heterosigma akashiwo GN=rpoB PE=3 SV=1 755 1101 7.0E-28
sp|Q92QH7|RPOB_RHIME DNA-directed RNA polymerase subunit beta OS=Rhizobium meliloti (strain 1021) GN=rpoB PE=3 SV=1 851 1127 8.0E-28
sp|P30760|RPOB_MYCLE DNA-directed RNA polymerase subunit beta OS=Mycobacterium leprae (strain TN) GN=rpoB PE=3 SV=2 649 1152 8.0E-28
sp|B8ZSC7|RPOB_MYCLB DNA-directed RNA polymerase subunit beta OS=Mycobacterium leprae (strain Br4923) GN=rpoB PE=3 SV=1 649 1152 8.0E-28
sp|Q5LMQ5|RPOB_RUEPO DNA-directed RNA polymerase subunit beta OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpoB PE=3 SV=1 897 1127 8.0E-28
sp|Q1XDN5|RPOB_PYRYE DNA-directed RNA polymerase subunit beta OS=Pyropia yezoensis GN=rpoB PE=3 SV=1 755 1127 9.0E-28
sp|Q8G069|RPOB_BRUSU DNA-directed RNA polymerase subunit beta OS=Brucella suis biovar 1 (strain 1330) GN=rpoB PE=3 SV=1 851 1127 1.0E-27
sp|A6U851|RPOB_SINMW DNA-directed RNA polymerase subunit beta OS=Sinorhizobium medicae (strain WSM419) GN=rpoB PE=3 SV=1 851 1127 1.0E-27
sp|B0RB25|RPOB_CLAMS DNA-directed RNA polymerase subunit beta OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=rpoB PE=3 SV=1 755 1142 1.0E-27
sp|A9M5R0|RPOB_BRUC2 DNA-directed RNA polymerase subunit beta OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rpoB PE=3 SV=1 851 1127 1.0E-27
sp|C0RJL1|RPOB_BRUMB DNA-directed RNA polymerase subunit beta OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rpoB PE=3 SV=1 851 1127 1.0E-27
sp|B0CH41|RPOB_BRUSI DNA-directed RNA polymerase subunit beta OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rpoB PE=3 SV=1 851 1127 1.0E-27
sp|A5VR15|RPOB_BRUO2 DNA-directed RNA polymerase subunit beta OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rpoB PE=3 SV=1 851 1127 1.0E-27
sp|Q8YHP8|RPOB_BRUME DNA-directed RNA polymerase subunit beta OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rpoB PE=3 SV=1 851 1127 1.0E-27
sp|Q57CP8|RPOB_BRUAB DNA-directed RNA polymerase subunit beta OS=Brucella abortus biovar 1 (strain 9-941) GN=rpoB PE=3 SV=1 851 1127 1.0E-27
sp|Q2YM15|RPOB_BRUA2 DNA-directed RNA polymerase subunit beta OS=Brucella abortus (strain 2308) GN=rpoB PE=3 SV=1 851 1127 1.0E-27
sp|B2S687|RPOB_BRUA1 DNA-directed RNA polymerase subunit beta OS=Brucella abortus (strain S19) GN=rpoB PE=3 SV=1 851 1127 1.0E-27
sp|Q160X7|RPOB_ROSDO DNA-directed RNA polymerase subunit beta OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpoB PE=3 SV=1 851 1127 1.0E-27
sp|C3MAX2|RPOB_RHISN DNA-directed RNA polymerase subunit beta OS=Rhizobium sp. (strain NGR234) GN=rpoB PE=3 SV=1 851 1127 1.0E-27
sp|Q1GK49|RPOB_RUEST DNA-directed RNA polymerase subunit beta OS=Ruegeria sp. (strain TM1040) GN=rpoB PE=3 SV=1 851 1127 1.0E-27
sp|Q7MX27|RPOB_PORGI DNA-directed RNA polymerase subunit beta OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rpoB PE=3 SV=1 888 1127 1.0E-27
sp|B2RL45|RPOB_PORG3 DNA-directed RNA polymerase subunit beta OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=rpoB PE=3 SV=1 888 1127 1.0E-27
sp|A8HTY8|RPOB_AZOC5 DNA-directed RNA polymerase subunit beta OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rpoB PE=3 SV=1 878 1127 1.0E-27
sp|P60283|RPOB_PHYPA DNA-directed RNA polymerase subunit beta OS=Physcomitrella patens subsp. patens GN=rpoB PE=3 SV=1 755 1119 1.0E-27
sp|A5CUC7|RPOB_CLAM3 DNA-directed RNA polymerase subunit beta OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=rpoB PE=3 SV=1 755 1142 2.0E-27
sp|A3PV78|RPOB_MYCSJ DNA-directed RNA polymerase subunit beta OS=Mycobacterium sp. (strain JLS) GN=rpoB PE=3 SV=1 670 1152 2.0E-27
sp|A0PM24|RPOB_MYCUA DNA-directed RNA polymerase subunit beta OS=Mycobacterium ulcerans (strain Agy99) GN=rpoB PE=3 SV=1 649 1152 2.0E-27
sp|A6X0A9|RPOB_OCHA4 DNA-directed RNA polymerase subunit beta OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rpoB PE=3 SV=1 851 1127 2.0E-27
sp|Q1BDF0|RPOB_MYCSS DNA-directed RNA polymerase subunit beta OS=Mycobacterium sp. (strain MCS) GN=rpoB PE=3 SV=2 670 1152 2.0E-27
sp|A1UBJ3|RPOB_MYCSK DNA-directed RNA polymerase subunit beta OS=Mycobacterium sp. (strain KMS) GN=rpoB PE=3 SV=1 670 1152 2.0E-27
sp|B2HSJ3|RPOB_MYCMM DNA-directed RNA polymerase subunit beta OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=rpoB PE=3 SV=1 649 1152 2.0E-27
sp|Q98N66|RPOB_RHILO DNA-directed RNA polymerase subunit beta OS=Rhizobium loti (strain MAFF303099) GN=rpoB PE=3 SV=1 878 1127 2.0E-27
sp|B9JVM8|RPOB_AGRVS DNA-directed RNA polymerase subunit beta OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rpoB PE=3 SV=1 878 1097 2.0E-27
sp|B8FEU1|RPOB_DESAA DNA-directed RNA polymerase subunit beta OS=Desulfatibacillum alkenivorans (strain AK-01) GN=rpoB PE=3 SV=1 897 1127 2.0E-27
sp|P60281|RPOB_MYCS2 DNA-directed RNA polymerase subunit beta OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rpoB PE=1 SV=1 670 1152 2.0E-27
sp|Q5YPE0|RPOB2_NOCFA DNA-directed RNA polymerase subunit beta 2 OS=Nocardia farcinica (strain IFM 10152) GN=rpoB2 PE=3 SV=1 755 1152 2.0E-27
sp|P08266|RPB2_DROME DNA-directed RNA polymerase II subunit RPB2 OS=Drosophila melanogaster GN=RpII140 PE=2 SV=2 98 536 6.0E-16
sp|P08518|RPB2_YEAST DNA-directed RNA polymerase II subunit RPB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPB2 PE=1 SV=2 133 560 5.0E-13
sp|Q54IZ9|RPC2_DICDI DNA-directed RNA polymerase III subunit rpc2 OS=Dictyostelium discoideum GN=polr3b PE=3 SV=1 121 529 6.0E-13
sp|Q6FLD5|RPB2_CANGA DNA-directed RNA polymerase II subunit RPB2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPB2 PE=3 SV=1 133 560 7.0E-12
sp|P0C8K2|RPB2_ASFK5 DNA-directed RNA polymerase subunit 2 OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-065 PE=3 SV=1 51 603 3.0E-08
sp|P42487|RPB2_ASFB7 DNA-directed RNA polymerase subunit 2 OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=Ba71V-053 PE=3 SV=1 51 603 4.0E-08
sp|P0C8K5|RPB2_ASFWA DNA-directed RNA polymerase subunit 2 OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-063 PE=3 SV=1 51 603 8.0E-08
sp|P0C8K4|RPB2_ASFP4 DNA-directed RNA polymerase subunit 2 OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-065 PE=3 SV=1 51 603 8.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0003899 DNA-directed 5'-3' RNA polymerase activity Yes
GO:0005634 nucleus Yes
GO:0006351 transcription, DNA-templated Yes
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0043229 intracellular organelle No
GO:0009059 macromolecule biosynthetic process No
GO:0097747 RNA polymerase activity No
GO:1901576 organic substance biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0043227 membrane-bounded organelle No
GO:0009058 biosynthetic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0043231 intracellular membrane-bounded organelle No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043226 organelle No
GO:0003676 nucleic acid binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0032774 RNA biosynthetic process No
GO:0034062 5'-3' RNA polymerase activity No
GO:0090304 nucleic acid metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0003824 catalytic activity No
GO:0016779 nucleotidyltransferase activity No
GO:0044237 cellular metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0140098 catalytic activity, acting on RNA No
GO:0016740 transferase activity No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0005575 cellular_component No
GO:1901360 organic cyclic compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3322
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5662 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6055
Ophiocordyceps camponoti-floridani Ophcf2|06390
Ophiocordyceps camponoti-rufipedis Ophun1|6936
Ophiocordyceps kimflemingae Ophio5|4868
Ophiocordyceps subramaniannii Hirsu2|6138

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5662
MKNKPPATEASRATDTEWDHQYNTLRREKLFRHPPVDRTAYPALQEAVDAHIKSFNAVFGTDEKPGLLDQGIMDI
GVKTYLDGDETTPLNERNQLHMRIKSVVLQKPMLPLSNPTTGPRYIEPAECRMRHSTYRGRLQTTLEYWSNRCWL
EKKSPSELVDAREESEELGGYFVVNGIEKIVRMLVLNRRNFPMAIVRQSFANRAADYTQYGVLIRCVRPDETSQT
NVLHYLKDGNVTFRFSWRKAEYVVPVMMILKALIDANDRQILEGLVGPKGSRSTRNTHLMDRVEIMLRTYKAYNL
HTRHDTRAYLGSKFRRILGIPACVGDDGVGTEFLRRIVLVHLGNVNVKETQNEDKFNLLLFMIRKLYALAAGECA
TDNPDAIQNQEVLLGGFLYGQIIKERLEEFLHETVRTTLREWIHRQPKITFTWDRFHTLFAGVMAKNARVDIGSA
LAYFLSTGNLSSPSGLDLSQTSGFSVVAEKLNFLRFISHFRAVHRGAFFAQLKTTTVRKLLPESWGFLCPVHTPD
GAPCGLLNHLAHKCEVMTEALNVSALSSLAADWGLSKESTAATDENVVVMLDGRILGWCSPAMSRHIADCLRHWK
VEGTNGVPLKLEIGYVPASSGGSYPGIYMSSKPARMVRPVKYLQTQKEDFVGPLEQPYMSIAVVASEAEAGETTH
VELDPTNMLSILANMTPFSDFNQSPRNMYQCQMGKQTMGTPGTAMSYRADNKTYRLQTGQTPLVRAPLHNTYGFD
NFPNGTNAVVAVLSYTAYDMDDAMIINQSAHQRGFGYGTIYKTKKIALADDKTRMQGEKVVRMIGFAPHGFGDEA
ERGVLDPDGLPRVGQRIAKGDALCAWHVVVHDRQGALVNVDRRTHYERYQDDEAGYIDQVHLLGAESGAEPLQTV
CIKVRVPREPFIGDKFSSRHGQKGVLSKLWPACDLPFSESGMQPDVIINPHAFPSRMTIGMFVESMAGKAGALHG
LAQDSTPFRFDEEHNTAADYFGQQLVRAGFNYHGNEPMYSGTTGQELGADIYIGLVYYQRLRHMVNDKYQARTKG
PVVRLTGQPVGGRSRSGGIRVGEMERDALLGHGTAFLLQDRLLNCSDYSQAWLCRVCGSFLSTQPTVTPFAPRKR
NVATIVRCRNCAVLVADDADIMHLQGEMWEDGLGNRWVGGEQTTQVAIPFVLKYLDVELAAMGIKLKYKVGRGGV
VYRTALRAIEPPKPVVAC*
Coding >OphauG2|5662
ATGAAAAACAAGCCCCCAGCCACCGAGGCATCGCGAGCCACAGACACGGAATGGGATCACCAATACAATACACTA
CGCCGCGAGAAGCTTTTCCGACACCCTCCTGTCGATAGGACTGCCTATCCTGCGCTCCAGGAAGCTGTAGATGCT
CACATCAAATCCTTCAATGCCGTCTTTGGCACCGATGAGAAGCCTGGCCTCTTGGACCAAGGCATAATGGACATT
GGCGTCAAGACCTATCTCGACGGCGACGAAACGACTCCCCTCAATGAACGAAACCAGCTACACATGCGCATCAAG
AGCGTGGTTTTGCAGAAGCCCATGTTGCCCCTGAGCAATCCGACGACGGGCCCCAGATACATTGAACCTGCTGAA
TGCAGGATGCGACACTCGACGTATCGCGGCAGGCTGCAAACTACATTGGAATACTGGTCGAATCGTTGCTGGCTG
GAAAAGAAATCGCCCTCTGAGCTCGTTGACGCTAGGGAGGAGTCGGAAGAGCTCGGTGGATACTTTGTCGTCAAC
GGCATTGAGAAGATTGTACGGATGCTGGTTCTAAACAGGCGCAACTTTCCAATGGCGATTGTCCGGCAAAGCTTT
GCGAACCGCGCCGCTGACTATACGCAATACGGCGTCCTCATCCGCTGTGTACGCCCCGACGAGACGTCTCAGACC
AACGTGTTGCACTACCTCAAGGATGGAAATGTCACATTTCGTTTCTCTTGGCGAAAGGCCGAGTATGTTGTTCCT
GTCATGATGATACTCAAGGCCTTGATAGACGCCAATGACCGCCAAATACTCGAAGGCTTGGTGGGCCCCAAGGGC
TCTCGGTCGACGCGCAATACCCACTTGATGGATCGAGTCGAGATCATGCTGAGGACTTATAAAGCCTACAATCTA
CACACGAGACACGACACGCGCGCATACCTTGGATCCAAGTTTCGCCGGATTCTCGGCATTCCGGCTTGTGTGGGA
GACGACGGCGTGGGCACCGAGTTCCTGAGGCGCATAGTTCTTGTTCATCTGGGCAATGTGAATGTCAAGGAGACG
CAAAACGAGGACAAGTTTAACCTGCTTCTGTTTATGATTCGGAAACTCTATGCGCTGGCAGCGGGCGAATGCGCG
ACGGACAACCCGGATGCCATACAAAATCAAGAGGTGCTTCTCGGAGGCTTTCTCTACGGCCAAATCATCAAGGAA
AGACTGGAAGAGTTTCTGCACGAGACTGTGCGAACCACACTGAGGGAATGGATTCACCGACAGCCAAAAATCACG
TTTACATGGGATCGCTTCCATACACTGTTTGCAGGAGTCATGGCCAAGAATGCGCGGGTTGATATTGGCAGTGCC
TTGGCGTACTTTTTGTCGACTGGCAATCTCAGTAGTCCATCAGGCCTGGACCTGTCGCAGACGTCGGGGTTTAGC
GTGGTGGCAGAAAAGCTCAACTTTCTTCGCTTCATCAGCCATTTCCGGGCAGTTCACCGCGGAGCCTTTTTTGCG
CAACTCAAGACGACGACTGTGCGGAAGCTTCTGCCCGAGTCGTGGGGGTTCCTGTGCCCGGTGCACACACCCGAC
GGCGCGCCTTGCGGGCTCCTGAATCATTTGGCGCACAAGTGTGAGGTGATGACTGAGGCGCTCAATGTCTCGGCG
CTTTCGTCACTGGCCGCGGACTGGGGACTGTCAAAGGAGTCGACTGCGGCGACTGATGAAAACGTGGTGGTGATG
CTGGACGGACGGATTCTTGGGTGGTGTTCGCCGGCAATGTCACGGCACATTGCCGACTGCCTCCGGCACTGGAAG
GTGGAGGGGACGAATGGGGTGCCGCTCAAGCTGGAAATCGGCTACGTGCCAGCGTCGAGCGGCGGCTCGTATCCC
GGCATCTACATGTCGTCCAAGCCGGCGAGGATGGTCAGGCCGGTCAAGTACCTGCAGACCCAAAAGGAGGACTTT
GTCGGCCCGCTGGAGCAGCCGTACATGTCGATTGCCGTGGTGGCGAGCGAGGCTGAAGCGGGCGAGACGACGCAT
GTCGAGCTTGACCCAACAAACATGCTGTCCATCCTGGCCAACATGACGCCCTTTTCCGACTTTAACCAGTCGCCG
CGAAACATGTACCAGTGCCAGATGGGCAAGCAGACCATGGGAACGCCGGGGACTGCCATGAGCTACCGCGCCGAC
AACAAGACGTACCGGCTGCAGACGGGCCAGACGCCGCTGGTGCGCGCTCCTCTGCACAACACGTATGGCTTTGAC
AACTTTCCAAACGGCACCAACGCCGTTGTTGCAGTGCTCTCGTACACGGCATACGACATGGACGACGCCATGATT
ATCAACCAGTCGGCCCACCAGCGCGGCTTTGGCTACGGCACCATCTACAAGACCAAGAAGATTGCGCTTGCCGAC
GACAAGACGCGCATGCAAGGCGAAAAGGTGGTGAGGATGATTGGCTTTGCGCCCCACGGCTTTGGCGACGAGGCG
GAGCGAGGCGTGCTGGACCCCGACGGCCTGCCGCGAGTTGGGCAGCGCATTGCAAAGGGCGACGCCCTGTGCGCG
TGGCATGTGGTTGTGCACGACCGCCAGGGCGCCCTGGTCAACGTGGACCGGCGGACGCATTACGAGCGCTACCAG
GACGACGAGGCTGGCTACATTGACCAGGTGCACCTGCTGGGGGCCGAGTCGGGCGCGGAGCCGCTGCAGACGGTG
TGCATCAAGGTGCGCGTCCCGCGCGAGCCCTTTATCGGCGACAAGTTTTCGTCGCGCCACGGCCAAAAGGGCGTG
CTGTCCAAGCTGTGGCCGGCGTGCGACCTGCCCTTTTCCGAGTCGGGCATGCAGCCAGACGTCATCATCAACCCC
CACGCCTTTCCCTCGCGCATGACGATTGGCATGTTTGTCGAGTCCATGGCGGGCAAGGCCGGCGCCCTGCACGGC
CTGGCCCAAGACTCGACGCCCTTTCGCTTTGACGAGGAGCACAACACGGCCGCCGACTACTTTGGCCAGCAGCTC
GTCCGCGCCGGCTTCAACTACCACGGCAACGAGCCCATGTACTCGGGCACCACGGGCCAGGAACTCGGCGCCGAC
ATCTACATTGGCCTCGTCTACTACCAGCGCCTGCGACACATGGTCAACGACAAGTACCAAGCCCGCACCAAGGGC
CCCGTGGTTCGCCTCACCGGCCAGCCCGTCGGCGGCCGCAGCCGCTCTGGCGGCATCCGCGTCGGCGAAATGGAG
CGCGACGCCCTGCTCGGCCACGGCACCGCCTTTCTGCTCCAGGACCGCCTGCTCAACTGCTCCGACTACTCGCAG
GCCTGGCTCTGCCGCGTCTGCGGCTCCTTTCTCTCCACCCAGCCCACCGTGACGCCCTTTGCCCCGCGCAAGCGC
AACGTGGCCACCATTGTGCGCTGCCGCAACTGCGCGGTCCTGGTGGCCGACGACGCCGACATTATGCACCTCCAG
GGCGAGATGTGGGAGGACGGCCTGGGCAACCGCTGGGTGGGCGGCGAGCAAACCACCCAAGTCGCCATTCCCTTT
GTGCTCAAGTACCTAGACGTCGAGCTGGCTGCCATGGGCATCAAGCTCAAGTACAAGGTGGGCCGGGGCGGAGTG
GTGTACAGAACAGCGCTTCGGGCGATTGAGCCTCCCAAGCCGGTGGTGGCGTGCTAA
Transcript >OphauG2|5662
ATGAAAAACAAGCCCCCAGCCACCGAGGCATCGCGAGCCACAGACACGGAATGGGATCACCAATACAATACACTA
CGCCGCGAGAAGCTTTTCCGACACCCTCCTGTCGATAGGACTGCCTATCCTGCGCTCCAGGAAGCTGTAGATGCT
CACATCAAATCCTTCAATGCCGTCTTTGGCACCGATGAGAAGCCTGGCCTCTTGGACCAAGGCATAATGGACATT
GGCGTCAAGACCTATCTCGACGGCGACGAAACGACTCCCCTCAATGAACGAAACCAGCTACACATGCGCATCAAG
AGCGTGGTTTTGCAGAAGCCCATGTTGCCCCTGAGCAATCCGACGACGGGCCCCAGATACATTGAACCTGCTGAA
TGCAGGATGCGACACTCGACGTATCGCGGCAGGCTGCAAACTACATTGGAATACTGGTCGAATCGTTGCTGGCTG
GAAAAGAAATCGCCCTCTGAGCTCGTTGACGCTAGGGAGGAGTCGGAAGAGCTCGGTGGATACTTTGTCGTCAAC
GGCATTGAGAAGATTGTACGGATGCTGGTTCTAAACAGGCGCAACTTTCCAATGGCGATTGTCCGGCAAAGCTTT
GCGAACCGCGCCGCTGACTATACGCAATACGGCGTCCTCATCCGCTGTGTACGCCCCGACGAGACGTCTCAGACC
AACGTGTTGCACTACCTCAAGGATGGAAATGTCACATTTCGTTTCTCTTGGCGAAAGGCCGAGTATGTTGTTCCT
GTCATGATGATACTCAAGGCCTTGATAGACGCCAATGACCGCCAAATACTCGAAGGCTTGGTGGGCCCCAAGGGC
TCTCGGTCGACGCGCAATACCCACTTGATGGATCGAGTCGAGATCATGCTGAGGACTTATAAAGCCTACAATCTA
CACACGAGACACGACACGCGCGCATACCTTGGATCCAAGTTTCGCCGGATTCTCGGCATTCCGGCTTGTGTGGGA
GACGACGGCGTGGGCACCGAGTTCCTGAGGCGCATAGTTCTTGTTCATCTGGGCAATGTGAATGTCAAGGAGACG
CAAAACGAGGACAAGTTTAACCTGCTTCTGTTTATGATTCGGAAACTCTATGCGCTGGCAGCGGGCGAATGCGCG
ACGGACAACCCGGATGCCATACAAAATCAAGAGGTGCTTCTCGGAGGCTTTCTCTACGGCCAAATCATCAAGGAA
AGACTGGAAGAGTTTCTGCACGAGACTGTGCGAACCACACTGAGGGAATGGATTCACCGACAGCCAAAAATCACG
TTTACATGGGATCGCTTCCATACACTGTTTGCAGGAGTCATGGCCAAGAATGCGCGGGTTGATATTGGCAGTGCC
TTGGCGTACTTTTTGTCGACTGGCAATCTCAGTAGTCCATCAGGCCTGGACCTGTCGCAGACGTCGGGGTTTAGC
GTGGTGGCAGAAAAGCTCAACTTTCTTCGCTTCATCAGCCATTTCCGGGCAGTTCACCGCGGAGCCTTTTTTGCG
CAACTCAAGACGACGACTGTGCGGAAGCTTCTGCCCGAGTCGTGGGGGTTCCTGTGCCCGGTGCACACACCCGAC
GGCGCGCCTTGCGGGCTCCTGAATCATTTGGCGCACAAGTGTGAGGTGATGACTGAGGCGCTCAATGTCTCGGCG
CTTTCGTCACTGGCCGCGGACTGGGGACTGTCAAAGGAGTCGACTGCGGCGACTGATGAAAACGTGGTGGTGATG
CTGGACGGACGGATTCTTGGGTGGTGTTCGCCGGCAATGTCACGGCACATTGCCGACTGCCTCCGGCACTGGAAG
GTGGAGGGGACGAATGGGGTGCCGCTCAAGCTGGAAATCGGCTACGTGCCAGCGTCGAGCGGCGGCTCGTATCCC
GGCATCTACATGTCGTCCAAGCCGGCGAGGATGGTCAGGCCGGTCAAGTACCTGCAGACCCAAAAGGAGGACTTT
GTCGGCCCGCTGGAGCAGCCGTACATGTCGATTGCCGTGGTGGCGAGCGAGGCTGAAGCGGGCGAGACGACGCAT
GTCGAGCTTGACCCAACAAACATGCTGTCCATCCTGGCCAACATGACGCCCTTTTCCGACTTTAACCAGTCGCCG
CGAAACATGTACCAGTGCCAGATGGGCAAGCAGACCATGGGAACGCCGGGGACTGCCATGAGCTACCGCGCCGAC
AACAAGACGTACCGGCTGCAGACGGGCCAGACGCCGCTGGTGCGCGCTCCTCTGCACAACACGTATGGCTTTGAC
AACTTTCCAAACGGCACCAACGCCGTTGTTGCAGTGCTCTCGTACACGGCATACGACATGGACGACGCCATGATT
ATCAACCAGTCGGCCCACCAGCGCGGCTTTGGCTACGGCACCATCTACAAGACCAAGAAGATTGCGCTTGCCGAC
GACAAGACGCGCATGCAAGGCGAAAAGGTGGTGAGGATGATTGGCTTTGCGCCCCACGGCTTTGGCGACGAGGCG
GAGCGAGGCGTGCTGGACCCCGACGGCCTGCCGCGAGTTGGGCAGCGCATTGCAAAGGGCGACGCCCTGTGCGCG
TGGCATGTGGTTGTGCACGACCGCCAGGGCGCCCTGGTCAACGTGGACCGGCGGACGCATTACGAGCGCTACCAG
GACGACGAGGCTGGCTACATTGACCAGGTGCACCTGCTGGGGGCCGAGTCGGGCGCGGAGCCGCTGCAGACGGTG
TGCATCAAGGTGCGCGTCCCGCGCGAGCCCTTTATCGGCGACAAGTTTTCGTCGCGCCACGGCCAAAAGGGCGTG
CTGTCCAAGCTGTGGCCGGCGTGCGACCTGCCCTTTTCCGAGTCGGGCATGCAGCCAGACGTCATCATCAACCCC
CACGCCTTTCCCTCGCGCATGACGATTGGCATGTTTGTCGAGTCCATGGCGGGCAAGGCCGGCGCCCTGCACGGC
CTGGCCCAAGACTCGACGCCCTTTCGCTTTGACGAGGAGCACAACACGGCCGCCGACTACTTTGGCCAGCAGCTC
GTCCGCGCCGGCTTCAACTACCACGGCAACGAGCCCATGTACTCGGGCACCACGGGCCAGGAACTCGGCGCCGAC
ATCTACATTGGCCTCGTCTACTACCAGCGCCTGCGACACATGGTCAACGACAAGTACCAAGCCCGCACCAAGGGC
CCCGTGGTTCGCCTCACCGGCCAGCCCGTCGGCGGCCGCAGCCGCTCTGGCGGCATCCGCGTCGGCGAAATGGAG
CGCGACGCCCTGCTCGGCCACGGCACCGCCTTTCTGCTCCAGGACCGCCTGCTCAACTGCTCCGACTACTCGCAG
GCCTGGCTCTGCCGCGTCTGCGGCTCCTTTCTCTCCACCCAGCCCACCGTGACGCCCTTTGCCCCGCGCAAGCGC
AACGTGGCCACCATTGTGCGCTGCCGCAACTGCGCGGTCCTGGTGGCCGACGACGCCGACATTATGCACCTCCAG
GGCGAGATGTGGGAGGACGGCCTGGGCAACCGCTGGGTGGGCGGCGAGCAAACCACCCAAGTCGCCATTCCCTTT
GTGCTCAAGTACCTAGACGTCGAGCTGGCTGCCATGGGCATCAAGCTCAAGTACAAGGTGGGCCGGGGCGGAGTG
GTGTACAGAACAGCGCTTCGGGCGATTGAGCCTCCCAAGCCGGTGGTGGCGTGCTAA
Gene >OphauG2|5662
ATGAAAAACAAGCCCCCAGCCACCGAGGCATCGCGAGCCACAGACACGGAATGGGATCACCAATACAATACACTA
CGCCGCGAGAAGCTTTTCCGACACCCTCCTGTCGATAGGACTGCCTATCCTGCGCTCCAGGAAGCTGTAGATGCT
CACATCAAATCCTTCAATGCCGTCTTTGGCACCGATGAGAAGCCTGGCCTCTTGGACCAAGGCATAATGGACATT
GGCGTCAAGACCTATCTCGACGGCGACGAAACGACTCCCCTCAATGAACGAAACCAGCTACACATGCGCATCAAG
AGCGTGGTTTTGCAGAAGCCCATGTTGCCCCTGAGCAATCCGACGACGGGCCCCAGATACATTGAACCTGCTGAA
TGCAGGATGCGACACTCGACGTATCGCGGCAGGCTGCAAACTACATTGGAATACTGGGTAAACAATGAATCTCCC
AGAGAATTGGCATTGGCCACGGGCCAAGCACCCATCATGATCAAGGCAAGCATTCACTGTTGCTCTGTTGGCTTT
GCCTCGCTAAAGATTGCTGACCCTTACTGGCTGTCTTAGTCGAATCGTTGCTGGCTGGAAAAGAAATCGCCCTCT
GAGCTCGTTGACGCTAGGGAGGAGTCGGAAGAGCTCGGTGGATACTTTGTCGTCAACGGCATTGAGAAGATTGTA
CGGATGCTGGTTCTAAACAGGCGCAACTTTCCAATGGCGATTGTCCGGCAAAGCTTTGCGAACCGCGCCGCTGAC
TATACGCAATACGGCGTCCTCATCCGCTGTGTACGCCCCGACGAGACGTCTCAGACCAACGTGTTGCACTACCTC
AAGGATGGAAATGTCACATTTCGTTTCTCTTGGCGAAAGGCCGAGTATGTTGTTCCTGTCATGATGATACTCAAG
GCCTTGATAGACGCCAATGACCGCCAAATACTCGAAGGCTTGGTGGGCCCCAAGGGCTCTCGGTCGACGCGCAAT
ACCCACTTGATGGATCGAGTCGAGATCATGCTGAGGACTTATAAAGCCTACAATCTACACACGAGACACGACACG
CGCGCATACCTTGGATCCAAGTTTCGCCGGATTCTCGGCATTCCGGCTTGTGTGGGAGACGACGGCGTGGGCACC
GAGTTCCTGAGGCGCATAGTTCTTGTTCATCTGGGCAATGTGAATGTCAAGGAGACGCAAAACGAGGACAAGTTT
AACCTGCTTCTGTTTATGATTCGGAAACTCTATGCGCTGGCAGCGGGCGAATGCGCGACGGACAACCCGGATGCC
ATACAAAATCAAGAGGTGCTTCTCGGAGGCTTTCTCTACGGCCAAATCATCAAGGAAAGACTGGAAGAGTTTCTG
CACGAGACTGTGCGAACCACACTGAGGGAATGGATTCACCGACAGCCAAAAATCACGTTTACATGGGATCGCTTC
CATACACTGTTTGCAGGAGTCATGGCCAAGAATGCGCGGGTTGATATTGGCAGTGCCTTGGCGTACTTTTTGTCG
ACTGGCAATCTCAGTAGTCCATCAGGCCTGGACCTGTCGCAGACGTCGGGGTTTAGCGTGGTGGCAGAAAAGCTC
AACTTTCTTCGCTTCATCAGCCATTTCCGGGCAGTTCACCGCGGAGCCTTTTTTGCGCAACTCAAGACGACGACT
GTGCGGAAGCTTCTGCCCGAGTCGTGGGGGTTCCTGTGCCCGGTGCACACACCCGACGGCGCGCCTTGCGGGCTC
CTGAATCATTTGGCGCACAAGTGTGAGGTGATGACTGAGGCGCTCAATGTCTCGGCGCTTTCGTCACTGGCCGCG
GACTGGGGACTGTCAAAGGAGTCGACTGCGGCGACTGATGAAAACGTGGTGGTGATGCTGGACGGACGGATTCTT
GGGTGGTGTTCGCCGGCAATGTCACGGCACATTGCCGACTGCCTCCGGCACTGGAAGGTGGAGGGGACGAATGGG
GTGCCGCTCAAGCTGGAAATCGGCTACGTGCCAGCGTCGAGCGGCGGCTCGTATCCCGGCATCTACATGTCGTCC
AAGCCGGCGAGGATGGTCAGGCCGGTCAAGTACCTGCAGACCCAAAAGGAGGACTTTGTCGGCCCGCTGGAGCAG
CCGTACATGTCGATTGCCGTGGTGGCGAGCGAGGCTGAAGCGGGCGAGACGACGCATGTCGAGCTTGACCCAACA
AACATGCTGTCCATCCTGGCCAACATGACGCCCTTTTCCGACTTTAACCAGTCGCCGCGAAACATGTACCAGTGC
CAGATGGGCAAGCAGACCATGGGAACGCCGGGGACTGCCATGAGCTACCGCGCCGACAACAAGACGTACCGGCTG
CAGACGGGCCAGACGCCGCTGGTGCGCGCTCCTCTGCACAACACGTATGGCTTTGACAACTTTCCAAACGGCACC
AACGCCGTTGTTGCAGTGCTCTCGTACACGGCATACGACATGGACGACGCCATGATTATCAACCAGTCGGCCCAC
CAGCGCGGCTTTGGCTACGGCACCATCTACAAGACCAAGAAGATTGCGCTTGCCGACGACAAGACGCGCATGCAA
GGCGAAAAGGTGGTGAGGATGATTGGCTTTGCGCCCCACGGCTTTGGCGACGAGGCGGAGCGAGGCGTGCTGGAC
CCCGACGGCCTGCCGCGAGTTGGGCAGCGCATTGCAAAGGGCGACGCCCTGTGCGCGTGGCATGTGGTTGTGCAC
GACCGCCAGGGCGCCCTGGTCAACGTGGACCGGCGGACGCATTACGAGCGCTACCAGGACGACGAGGCTGGCTAC
ATTGACCAGGTGCACCTGCTGGGGGCCGAGTCGGGCGCGGAGCCGCTGCAGACGGTGTGCATCAAGGTGCGCGTC
CCGCGCGAGCCCTTTATCGGCGACAAGTTTTCGTCGCGCCACGGCCAAAAGGGCGTGCTGTCCAAGCTGTGGCCG
GCGTGCGACCTGCCCTTTTCCGAGTCGGGCATGCAGCCAGACGTCATCATCAACCCCCACGCCTTTCCCTCGCGC
ATGACGATTGGCATGTTTGTCGAGTCCATGGCGGGCAAGGCCGGCGCCCTGCACGGCCTGGCCCAAGACTCGACG
CCCTTTCGCTTTGACGAGGAGCACAACACGGCCGCCGACTACTTTGGCCAGCAGCTCGTCCGCGCCGGCTTCAAC
TACCACGGCAACGAGCCCATGTACTCGGGCACCACGGGCCAGGAACTCGGCGCCGACATCTACATTGGCCTCGTC
TACTACCAGCGCCTGCGACACATGGTCAACGACAAGTACCAAGCCCGCACCAAGGGCCCCGTGGTTCGCCTCACC
GGCCAGCCCGTCGGCGGCCGCAGCCGCTCTGGCGGCATCCGCGTCGGCGAAATGGAGCGCGACGCCCTGCTCGGC
CACGGCACCGCCTTTCTGCTCCAGGACCGCCTGCTCAACTGCTCCGACTACTCGCAGGCCTGGCTCTGCCGCGTC
TGCGGCTCCTTTCTCTCCACCCAGCCCACCGTGACGCCCTTTGCCCCGCGCAAGCGCAACGTGGCCACCATTGTG
CGCTGCCGCAACTGCGCGGTCCTGGTGGCCGACGACGCCGACATTATGCACCTCCAGGGCGAGATGTGGGAGGAC
GGCCTGGGCAACCGCTGGGTGGGCGGCGAGCAAACCACCCAAGTCGCCATTCCCTTTGTGCTCAAGTACCTAGAC
GTCGAGCTGGCTGCCATGGGCATCAAGCTCAAGTACAAGGTGGGCCGGGGCGGAGTGGTGTACAGAACAGCGCTT
CGGGCGATTGAGCCTCCCAAGCCGGTGGTGGCGTGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail