Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5622
Gene name
LocationContig_525:7833..8856
Strand+
Gene length (bp)1023
Transcript length (bp)1023
Coding sequence length (bp)1023
Protein length (aa) 341

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06687 SUR7 SUR7/PalI family 1.6E-33 8 247

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13729|PUN1_SCHPO SUR7 family protein pun1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pun1 PE=3 SV=1 17 248 3.0E-06

GO

GO Term Description Terminal node
GO:0005886 plasma membrane Yes
GO:0005575 cellular_component No
GO:0016020 membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 155 177 22
3 187 209 22
4 230 252 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5622
MGVGRFACVALPLILILASIIALLVATLAGVTHHSMHMFSVNVSELSINPASIGNIANTLGVNLETRVDALQSDN
ITAGNLGLNDTYDISLWGYCTTDRDGRRHCTKAQFDWATHKLNTTWIENFGAAAGVHITLPDQVQSALRAFRTVT
RWTEVAFIVALVALGVEFFIGILANMSRVISCLTWFISIVAVVLVGAAAGLATATASIVIGAIEGTAKYYGVRGS
IDTRFLAAVWIATAFALGAAFFWIFTICCCKPERRSRGAYRNTNKHASSDDEKLLPSRGYAPLGNDREMSGGAYY
EGNNQHHMSMAPPLHSPQPPSYSGSNDRANMAYEPYSHRV*
Coding >OphauG2|5622
ATGGGTGTCGGACGTTTTGCCTGTGTGGCTCTGCCACTGATTCTCATCTTGGCATCCATTATTGCTCTTCTCGTT
GCCACACTCGCAGGCGTCACACATCACAGCATGCACATGTTCAGCGTCAACGTCTCGGAGCTCTCCATCAATCCG
GCAAGCATAGGCAACATTGCCAATACACTGGGAGTCAACCTCGAGACCCGCGTCGATGCCCTACAGTCAGATAAC
ATCACGGCCGGCAACCTTGGCCTCAACGACACCTACGACATCAGCCTCTGGGGCTATTGCACCACAGACAGAGAC
GGCCGTCGCCATTGCACAAAGGCCCAGTTTGATTGGGCCACGCACAAGCTCAACACAACTTGGATCGAAAACTTT
GGTGCTGCCGCCGGCGTCCATATTACTCTGCCTGACCAAGTCCAGAGCGCGCTGCGTGCCTTCCGTACCGTCACG
CGATGGACCGAGGTGGCATTCATCGTGGCCCTGGTAGCCCTTGGCGTCGAGTTTTTCATTGGCATCCTTGCCAAT
ATGTCACGAGTAATATCATGCTTGACATGGTTCATCTCCATTGTGGCCGTGGTACTCGTGGGCGCTGCCGCTGGT
CTGGCCACGGCCACGGCATCCATTGTTATTGGTGCCATCGAGGGCACGGCCAAGTACTACGGAGTCCGGGGCTCC
ATCGACACACGCTTCCTGGCTGCTGTTTGGATAGCAACAGCGTTTGCACTCGGAGCAGCCTTCTTCTGGATCTTT
ACCATTTGCTGCTGCAAGCCTGAACGTCGCAGCCGCGGCGCCTACCGCAACACCAACAAGCATGCCTCATCAGAC
GACGAGAAGTTGCTTCCCTCCAGGGGCTATGCGCCTTTGGGGAACGACCGCGAAATGAGTGGAGGCGCCTATTAT
GAGGGCAACAATCAGCACCATATGAGCATGGCGCCTCCTTTGCACTCGCCGCAGCCGCCAAGTTATTCAGGCTCC
AACGATCGGGCAAATATGGCCTATGAGCCCTACTCACACCGAGTATAA
Transcript >OphauG2|5622
ATGGGTGTCGGACGTTTTGCCTGTGTGGCTCTGCCACTGATTCTCATCTTGGCATCCATTATTGCTCTTCTCGTT
GCCACACTCGCAGGCGTCACACATCACAGCATGCACATGTTCAGCGTCAACGTCTCGGAGCTCTCCATCAATCCG
GCAAGCATAGGCAACATTGCCAATACACTGGGAGTCAACCTCGAGACCCGCGTCGATGCCCTACAGTCAGATAAC
ATCACGGCCGGCAACCTTGGCCTCAACGACACCTACGACATCAGCCTCTGGGGCTATTGCACCACAGACAGAGAC
GGCCGTCGCCATTGCACAAAGGCCCAGTTTGATTGGGCCACGCACAAGCTCAACACAACTTGGATCGAAAACTTT
GGTGCTGCCGCCGGCGTCCATATTACTCTGCCTGACCAAGTCCAGAGCGCGCTGCGTGCCTTCCGTACCGTCACG
CGATGGACCGAGGTGGCATTCATCGTGGCCCTGGTAGCCCTTGGCGTCGAGTTTTTCATTGGCATCCTTGCCAAT
ATGTCACGAGTAATATCATGCTTGACATGGTTCATCTCCATTGTGGCCGTGGTACTCGTGGGCGCTGCCGCTGGT
CTGGCCACGGCCACGGCATCCATTGTTATTGGTGCCATCGAGGGCACGGCCAAGTACTACGGAGTCCGGGGCTCC
ATCGACACACGCTTCCTGGCTGCTGTTTGGATAGCAACAGCGTTTGCACTCGGAGCAGCCTTCTTCTGGATCTTT
ACCATTTGCTGCTGCAAGCCTGAACGTCGCAGCCGCGGCGCCTACCGCAACACCAACAAGCATGCCTCATCAGAC
GACGAGAAGTTGCTTCCCTCCAGGGGCTATGCGCCTTTGGGGAACGACCGCGAAATGAGTGGAGGCGCCTATTAT
GAGGGCAACAATCAGCACCATATGAGCATGGCGCCTCCTTTGCACTCGCCGCAGCCGCCAAGTTATTCAGGCTCC
AACGATCGGGCAAATATGGCCTATGAGCCCTACTCACACCGAGTATAA
Gene >OphauG2|5622
ATGGGTGTCGGACGTTTTGCCTGTGTGGCTCTGCCACTGATTCTCATCTTGGCATCCATTATTGCTCTTCTCGTT
GCCACACTCGCAGGCGTCACACATCACAGCATGCACATGTTCAGCGTCAACGTCTCGGAGCTCTCCATCAATCCG
GCAAGCATAGGCAACATTGCCAATACACTGGGAGTCAACCTCGAGACCCGCGTCGATGCCCTACAGTCAGATAAC
ATCACGGCCGGCAACCTTGGCCTCAACGACACCTACGACATCAGCCTCTGGGGCTATTGCACCACAGACAGAGAC
GGCCGTCGCCATTGCACAAAGGCCCAGTTTGATTGGGCCACGCACAAGCTCAACACAACTTGGATCGAAAACTTT
GGTGCTGCCGCCGGCGTCCATATTACTCTGCCTGACCAAGTCCAGAGCGCGCTGCGTGCCTTCCGTACCGTCACG
CGATGGACCGAGGTGGCATTCATCGTGGCCCTGGTAGCCCTTGGCGTCGAGTTTTTCATTGGCATCCTTGCCAAT
ATGTCACGAGTAATATCATGCTTGACATGGTTCATCTCCATTGTGGCCGTGGTACTCGTGGGCGCTGCCGCTGGT
CTGGCCACGGCCACGGCATCCATTGTTATTGGTGCCATCGAGGGCACGGCCAAGTACTACGGAGTCCGGGGCTCC
ATCGACACACGCTTCCTGGCTGCTGTTTGGATAGCAACAGCGTTTGCACTCGGAGCAGCCTTCTTCTGGATCTTT
ACCATTTGCTGCTGCAAGCCTGAACGTCGCAGCCGCGGCGCCTACCGCAACACCAACAAGCATGCCTCATCAGAC
GACGAGAAGTTGCTTCCCTCCAGGGGCTATGCGCCTTTGGGGAACGACCGCGAAATGAGTGGAGGCGCCTATTAT
GAGGGCAACAATCAGCACCATATGAGCATGGCGCCTCCTTTGCACTCGCCGCAGCCGCCAAGTTATTCAGGCTCC
AACGATCGGGCAAATATGGCCTATGAGCCCTACTCACACCGAGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail