Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|562
Gene name
LocationContig_1133:873..5425
Strand-
Gene length (bp)4552
Transcript length (bp)4323
Coding sequence length (bp)4323
Protein length (aa) 1441

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13844 Glyco_transf_41 Glycosyl transferase family 41 3.3E-48 948 1132
PF13844 Glyco_transf_41 Glycosyl transferase family 41 6.4E-45 1191 1371
PF13181 TPR_8 Tetratricopeptide repeat 4.1E-02 722 747
PF13181 TPR_8 Tetratricopeptide repeat 3.9E-02 756 786

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 696 1427 4.0E-93
sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 1184 1430 8.0E-38
sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 1184 1430 9.0E-38
sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 1184 1430 2.0E-37
sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 1184 1430 4.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 696 1427 4.0E-93
sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 1184 1430 8.0E-38
sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 1184 1430 9.0E-38
sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 1184 1430 2.0E-37
sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 1184 1430 4.0E-37
sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans GN=ogt-1 PE=1 SV=2 1208 1430 1.0E-36
sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 1184 1430 9.0E-36
sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 949 1179 1.0E-35
sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 949 1179 1.0E-35
sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 949 1179 1.0E-35
sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 949 1179 1.0E-35
sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 949 1179 1.0E-35
sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans GN=ogt-1 PE=1 SV=2 949 1179 1.0E-33
sp|O82039|SPY_PETHY Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida GN=SPY PE=2 SV=1 996 1430 4.0E-23
sp|Q96301|SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana GN=SPY PE=1 SV=1 996 1430 9.0E-22
sp|O82422|SPY_HORVU Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Hordeum vulgare GN=SPY PE=2 SV=1 995 1430 8.0E-20
sp|Q6YZI0|SPY_ORYSJ Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Oryza sativa subsp. japonica GN=SPY PE=3 SV=1 995 1430 2.0E-19
sp|Q8RVB2|SPY_SOLLC Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum GN=SPY PE=2 SV=1 984 1430 7.0E-19
sp|Q8LP10|SPY_EUSER Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Eustoma exaltatum subsp. russellianum GN=SPY PE=2 SV=1 995 1438 8.0E-18
sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 705 804 7.0E-10
sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 705 804 7.0E-10
sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 705 804 7.0E-10
sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 705 804 8.0E-10
sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 705 804 8.0E-10
sp|A8BFN4|OGT1_GIAIC UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Giardia intestinalis (strain ATCC 50803 / WB clone C6) GN=GL50803_12081 PE=1 SV=1 1207 1436 1.0E-09
sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 668 823 3.0E-09
sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans GN=ogt-1 PE=1 SV=2 704 798 7.0E-09
sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 712 794 2.0E-08
sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans GN=ogt-1 PE=1 SV=2 705 804 3.0E-08
sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 704 798 7.0E-08
sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 704 798 7.0E-08
sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 704 798 7.0E-08
sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 704 798 7.0E-08
sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 704 798 8.0E-08
sp|A8BFN4|OGT1_GIAIC UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Giardia intestinalis (strain ATCC 50803 / WB clone C6) GN=GL50803_12081 PE=1 SV=1 1002 1131 1.0E-07
sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 705 819 2.0E-07
sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 705 819 2.0E-07
sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 705 819 2.0E-07
sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 705 819 2.0E-07
sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 705 819 2.0E-07
sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 709 806 1.0E-06
sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 709 806 1.0E-06
sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 709 806 1.0E-06
sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 709 806 1.0E-06
sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 709 806 1.0E-06
sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans GN=ogt-1 PE=1 SV=2 705 790 3.0E-06
sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans GN=ogt-1 PE=1 SV=2 709 794 4.0E-06
sp|O82422|SPY_HORVU Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Hordeum vulgare GN=SPY PE=2 SV=1 695 805 6.0E-06
sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 705 794 6.0E-06
sp|Q6YZI0|SPY_ORYSJ Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Oryza sativa subsp. japonica GN=SPY PE=3 SV=1 717 805 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5075
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|562 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4588
Ophiocordyceps camponoti-floridani Ophcf2|06070
Ophiocordyceps camponoti-rufipedis Ophun1|6592
Ophiocordyceps kimflemingae Ophio5|7555
Ophiocordyceps subramaniannii Hirsu2|2911

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|562
MPQNSETQQSSAGGARQHRRSRQHSQLRRKTPSGVVDAGYEAVDHDGNAQGAGSPPLKQFIIAATIPAAATTTMG
HGGSRPLARPVRASRCSAPRSTRPWDPSPAHQHVSSWTDKDEALWLSLDQSQSLAQPTENKIWAVYRPPPPVMEP
FALGLQSCWSSPFRTADSGSQGYSRYPASNPYLPLSHGVYSPPHSIWQLPAPSNWAGSSAATIDRQSACARRSLT
RVRPQLGTKEKALACGYRSYIDLLACLQASGRPGSVCLGGSRLSIYPRPPKPTFGSLQAGPRESSIFLSSLFDLG
LPTQRPGQAQLAPSIDATPQLSCAVSNAASQPKQSLGVSYWSHVQNETTASPISSAKSALEVVHNVCEQSGWHWL
DGMLLGGCLCYGLGRYQDAIQWFSRILHIDSSHVETMTNMAAALYCLDRQSEAEQFWLDAIKLRPSYLEAAEHLV
GLLYRKRGPEAVQVVSYVQRALRLPDSSLTTHHESRVERKDYGSSGYALPATENGRLLALVHAKGTMLYNLKQVT
KAAEAFEEAVLIATGRRLGKIEHIIRRVQCVLSPPGISDPESWRPLMLPPERARCTAQLVFSGAEEPPGLSSLRN
GASKRAAVQTTSNSLLSLAKIFQDGLSSGNADLCLLVRPSSTVGDVLALYYLSLSLQESPSTANNIGILLAGLQH
TAALPAVFSGRNLIQAAIPGIRPGSGMSFALAYYNYGLGLDPKHVHLHTNLGSLLKDMGLLDLAISMYERAVACD
GSFDIALTNLANAVKDKGRINDAIVYYRRAVDANPAFCEAVCGLFTALNSVCNWQGRGGVLLECGKYDRWHVDEE
GVLHDVLATGRGSGLTQRVVDIVAEQLRDASLWGQHALEASTKATLTHELEWLCDEGCFRLEDALQHWSGRPWEG
SRLVRLLERAARVTQHQWYKDVYVSPSRGKGRSYSRPSLPRHVSVPTTPTVLPFHTFTCPLAARDIRAISQRNAL
RITCSTLRSSWLPASVYPPPRPPQPQLNVGYVSSDFNNHPLAHLMQSVFGLHNSTRVKAFCYATTSSDNSTHRRQ
IEREAPVFREVSNWPLDKVIDIIIQDEIHILVNLNGYTRGARNEIFAARPVPVQMSFMGFAGSLGAEWCDYILAD
TTAIPPETLRPWRSNTSIQDVFEDGNEDDEDGDWVYSENIIFCRDTFFCCDHAQSCGANERATTWGQEQQRRWAM
RKAMFPGMADDVVILANFNQLYKIEPTTFRSWLRILTRVPKAVLWLLRFPEAGERNLRVTAEAWAGAEVASRLFF
TDVAAKSHHISRARVCDLFLDTPECNAHTTAADVLWSSTPLLTLPRYPYKMCSRMAASILRGALPRSSEGRRVAE
ELIVKNEAEYESAAVRLASGLRYAPVALDEPASPSYCEGHGRLAEMRRLLWDSKWSCGLFDTQRWVDDVETAYHE
AWRRWVHEIGGDIYL*
Coding >OphauG2|562
ATGCCACAAAACTCGGAGACTCAGCAGTCGAGTGCTGGCGGCGCCCGACAACATCGGCGCTCGCGCCAGCACAGC
CAATTGCGCCGAAAAACTCCTAGTGGGGTTGTCGACGCGGGATATGAAGCGGTAGACCATGATGGAAATGCGCAA
GGCGCCGGCTCGCCCCCGTTAAAACAGTTCATCATTGCTGCTACGATTCCAGCGGCCGCGACGACGACCATGGGT
CATGGCGGCTCCAGACCTCTTGCCCGGCCTGTTCGCGCTTCTCGGTGTTCTGCGCCGCGGTCGACGAGGCCATGG
GATCCGTCGCCTGCGCACCAACATGTGTCCTCTTGGACTGACAAGGACGAAGCACTCTGGCTGAGCCTGGACCAA
TCCCAGTCATTGGCCCAGCCCACGGAGAACAAGATTTGGGCTGTTTACCGTCCACCACCTCCGGTAATGGAGCCA
TTTGCTCTTGGCTTGCAATCGTGTTGGTCCTCTCCCTTTCGGACAGCAGATTCAGGCAGTCAGGGGTATAGCCGC
TACCCAGCAAGCAACCCTTATTTGCCACTCAGCCACGGCGTCTACTCCCCTCCCCATAGCATCTGGCAGCTTCCA
GCACCAAGCAACTGGGCTGGCAGCAGCGCTGCAACTATTGATCGGCAGTCGGCATGCGCACGACGTTCCTTGACA
CGCGTGCGCCCGCAGCTCGGCACCAAAGAAAAGGCTCTGGCCTGTGGCTATCGAAGTTACATTGATTTGCTAGCC
TGTCTTCAAGCCAGTGGCCGGCCCGGTTCTGTCTGTCTCGGAGGCTCTAGGCTGTCGATATATCCTCGACCTCCC
AAACCAACTTTCGGGTCGTTACAGGCCGGCCCCCGCGAGAGCTCCATATTCCTCTCTTCGCTCTTTGATCTTGGC
CTCCCCACACAACGTCCTGGACAAGCACAGCTTGCGCCGAGCATCGATGCTACTCCCCAGCTGTCTTGTGCAGTC
TCCAATGCAGCTAGTCAACCAAAGCAGTCATTAGGTGTCTCATATTGGAGTCATGTACAGAATGAAACAACAGCT
TCGCCCATTTCAAGCGCTAAATCGGCCTTGGAGGTGGTCCATAATGTCTGCGAGCAGAGCGGCTGGCACTGGCTT
GATGGCATGTTGCTAGGGGGCTGTCTTTGCTATGGTCTAGGCCGTTACCAGGACGCCATACAATGGTTCTCGAGA
ATTCTCCACATAGACTCGAGTCATGTAGAAACCATGACCAACATGGCTGCTGCCCTTTATTGCCTTGATCGGCAG
AGCGAAGCCGAGCAGTTTTGGCTCGATGCTATTAAGCTACGCCCCAGTTACTTGGAAGCTGCCGAACACCTCGTG
GGTCTTCTTTACAGGAAACGCGGCCCTGAAGCTGTACAGGTCGTATCGTATGTGCAGCGAGCCCTGAGGTTGCCA
GACTCATCGCTCACCACTCACCATGAGAGCCGTGTCGAGCGCAAGGACTATGGCTCAAGTGGCTATGCCTTGCCA
GCGACGGAAAATGGTAGATTATTGGCTCTGGTTCATGCCAAGGGGACCATGCTCTACAATTTGAAACAAGTTACA
AAGGCTGCTGAAGCATTCGAAGAAGCCGTATTGATTGCTACTGGACGGCGCCTTGGCAAAATTGAACATATTATA
CGGCGTGTTCAATGCGTGCTCTCTCCGCCCGGGATTTCGGACCCTGAGTCATGGCGCCCTCTGATGCTGCCGCCG
GAAAGAGCTCGATGCACGGCACAACTCGTATTCTCTGGTGCCGAGGAGCCCCCAGGCCTTTCGTCTCTGCGTAAC
GGGGCGTCGAAACGAGCGGCGGTACAGACTACGAGCAACTCACTGCTATCTTTGGCAAAGATTTTTCAAGATGGC
TTGTCAAGCGGCAATGCAGACTTGTGCCTGCTCGTGCGACCATCATCGACTGTGGGCGATGTATTAGCACTATAC
TATCTCTCTCTGTCTCTACAGGAGAGTCCTTCGACCGCGAACAATATTGGTATCCTCTTGGCTGGCCTTCAGCAC
ACGGCTGCACTGCCAGCTGTGTTTTCTGGCAGAAATCTGATACAGGCTGCTATACCCGGTATCAGGCCAGGAAGC
GGAATGTCTTTTGCATTGGCATACTACAATTACGGCCTTGGTTTAGATCCCAAGCATGTCCATCTCCATACTAAT
CTAGGCAGTCTTTTAAAAGATATGGGTCTACTCGATCTCGCCATTTCAATGTATGAGCGCGCCGTCGCCTGCGAC
GGTTCTTTTGATATTGCCCTCACGAACCTTGCCAACGCGGTCAAAGATAAGGGTCGCATCAATGATGCCATAGTC
TACTACCGTCGTGCTGTTGACGCAAACCCTGCATTCTGCGAAGCAGTGTGTGGACTCTTTACAGCACTCAACTCA
GTCTGCAATTGGCAGGGTCGCGGTGGGGTTCTTTTGGAATGTGGAAAATACGACCGGTGGCATGTCGACGAGGAG
GGCGTCTTGCACGACGTGTTGGCGACGGGTCGCGGGAGCGGCCTGACACAACGCGTTGTTGACATAGTGGCGGAG
CAGCTCAGGGACGCATCCCTTTGGGGGCAGCATGCACTTGAAGCATCGACAAAGGCCACCCTGACACACGAGCTT
GAATGGCTTTGTGACGAGGGATGCTTCCGGCTAGAGGATGCACTGCAGCATTGGTCGGGCAGGCCATGGGAGGGC
TCGCGTTTGGTGCGACTGCTAGAGCGTGCGGCGCGAGTAACACAGCACCAATGGTACAAAGACGTGTACGTGTCA
CCGAGCAGAGGCAAAGGACGATCGTATTCTCGCCCCAGCTTGCCTCGGCATGTCTCGGTGCCGACGACACCGACG
GTACTCCCCTTTCACACCTTTACCTGCCCGCTCGCGGCCAGGGACATTCGAGCAATCTCTCAGCGCAATGCTCTG
CGAATAACGTGCTCGACGCTGCGGTCGTCGTGGCTGCCGGCCTCGGTGTATCCACCACCACGGCCGCCACAGCCG
CAGCTCAATGTCGGGTATGTCTCGTCAGACTTTAACAATCACCCCTTGGCTCATCTAATGCAATCCGTGTTTGGC
TTGCACAATTCAACCCGAGTCAAGGCCTTTTGCTACGCCACGACCAGCAGCGACAACTCGACGCACCGCCGTCAG
ATTGAGAGAGAGGCCCCCGTATTTCGAGAGGTTAGCAACTGGCCGTTGGACAAGGTTATTGACATTATTATTCAA
GACGAGATTCACATTCTGGTTAATCTCAACGGCTATACCCGCGGTGCACGTAATGAAATATTTGCTGCTAGACCC
GTACCTGTGCAGATGTCCTTTATGGGATTCGCGGGTAGCTTGGGTGCAGAGTGGTGTGACTATATTCTCGCGGAC
ACGACGGCTATCCCGCCCGAGACGCTGCGTCCGTGGAGAAGCAACACTAGCATCCAAGATGTCTTTGAGGACGGC
AACGAGGATGACGAGGACGGTGATTGGGTATACTCGGAGAACATCATATTCTGCCGGGACACATTTTTTTGCTGC
GATCATGCTCAGTCATGCGGCGCAAACGAGCGGGCAACGACGTGGGGACAGGAGCAACAGAGGAGATGGGCTATG
CGCAAGGCCATGTTTCCCGGCATGGCAGACGATGTGGTTATTCTCGCCAACTTTAACCAGCTGTACAAGATTGAG
CCAACGACATTTCGGTCGTGGCTACGCATCCTGACGCGGGTCCCCAAGGCTGTCTTGTGGTTGCTACGATTTCCC
GAGGCTGGGGAGCGCAATCTTCGAGTAACGGCAGAGGCATGGGCGGGGGCCGAGGTGGCTAGTCGGCTGTTTTTT
ACCGACGTGGCGGCCAAAAGCCATCACATCTCACGAGCACGCGTATGCGATTTATTCCTCGACACGCCCGAGTGC
AATGCGCATACTACGGCCGCTGACGTGCTGTGGTCAAGCACGCCACTACTTACACTGCCGCGATACCCCTACAAG
ATGTGTTCACGCATGGCTGCCTCGATTCTGCGTGGAGCGCTTCCGCGGTCGAGTGAGGGCAGACGGGTGGCTGAG
GAGCTGATTGTGAAGAACGAGGCTGAGTACGAGAGTGCAGCAGTCAGGCTAGCCAGCGGGCTAAGATATGCACCA
GTGGCACTAGACGAGCCCGCATCACCAAGTTACTGCGAGGGCCACGGACGCTTGGCCGAGATGCGCAGGCTACTA
TGGGATAGCAAGTGGAGCTGTGGACTGTTTGATACGCAACGCTGGGTCGACGATGTAGAGACTGCCTATCACGAG
GCATGGCGGAGATGGGTCCATGAAATTGGAGGTGACATTTATCTTTAG
Transcript >OphauG2|562
ATGCCACAAAACTCGGAGACTCAGCAGTCGAGTGCTGGCGGCGCCCGACAACATCGGCGCTCGCGCCAGCACAGC
CAATTGCGCCGAAAAACTCCTAGTGGGGTTGTCGACGCGGGATATGAAGCGGTAGACCATGATGGAAATGCGCAA
GGCGCCGGCTCGCCCCCGTTAAAACAGTTCATCATTGCTGCTACGATTCCAGCGGCCGCGACGACGACCATGGGT
CATGGCGGCTCCAGACCTCTTGCCCGGCCTGTTCGCGCTTCTCGGTGTTCTGCGCCGCGGTCGACGAGGCCATGG
GATCCGTCGCCTGCGCACCAACATGTGTCCTCTTGGACTGACAAGGACGAAGCACTCTGGCTGAGCCTGGACCAA
TCCCAGTCATTGGCCCAGCCCACGGAGAACAAGATTTGGGCTGTTTACCGTCCACCACCTCCGGTAATGGAGCCA
TTTGCTCTTGGCTTGCAATCGTGTTGGTCCTCTCCCTTTCGGACAGCAGATTCAGGCAGTCAGGGGTATAGCCGC
TACCCAGCAAGCAACCCTTATTTGCCACTCAGCCACGGCGTCTACTCCCCTCCCCATAGCATCTGGCAGCTTCCA
GCACCAAGCAACTGGGCTGGCAGCAGCGCTGCAACTATTGATCGGCAGTCGGCATGCGCACGACGTTCCTTGACA
CGCGTGCGCCCGCAGCTCGGCACCAAAGAAAAGGCTCTGGCCTGTGGCTATCGAAGTTACATTGATTTGCTAGCC
TGTCTTCAAGCCAGTGGCCGGCCCGGTTCTGTCTGTCTCGGAGGCTCTAGGCTGTCGATATATCCTCGACCTCCC
AAACCAACTTTCGGGTCGTTACAGGCCGGCCCCCGCGAGAGCTCCATATTCCTCTCTTCGCTCTTTGATCTTGGC
CTCCCCACACAACGTCCTGGACAAGCACAGCTTGCGCCGAGCATCGATGCTACTCCCCAGCTGTCTTGTGCAGTC
TCCAATGCAGCTAGTCAACCAAAGCAGTCATTAGGTGTCTCATATTGGAGTCATGTACAGAATGAAACAACAGCT
TCGCCCATTTCAAGCGCTAAATCGGCCTTGGAGGTGGTCCATAATGTCTGCGAGCAGAGCGGCTGGCACTGGCTT
GATGGCATGTTGCTAGGGGGCTGTCTTTGCTATGGTCTAGGCCGTTACCAGGACGCCATACAATGGTTCTCGAGA
ATTCTCCACATAGACTCGAGTCATGTAGAAACCATGACCAACATGGCTGCTGCCCTTTATTGCCTTGATCGGCAG
AGCGAAGCCGAGCAGTTTTGGCTCGATGCTATTAAGCTACGCCCCAGTTACTTGGAAGCTGCCGAACACCTCGTG
GGTCTTCTTTACAGGAAACGCGGCCCTGAAGCTGTACAGGTCGTATCGTATGTGCAGCGAGCCCTGAGGTTGCCA
GACTCATCGCTCACCACTCACCATGAGAGCCGTGTCGAGCGCAAGGACTATGGCTCAAGTGGCTATGCCTTGCCA
GCGACGGAAAATGGTAGATTATTGGCTCTGGTTCATGCCAAGGGGACCATGCTCTACAATTTGAAACAAGTTACA
AAGGCTGCTGAAGCATTCGAAGAAGCCGTATTGATTGCTACTGGACGGCGCCTTGGCAAAATTGAACATATTATA
CGGCGTGTTCAATGCGTGCTCTCTCCGCCCGGGATTTCGGACCCTGAGTCATGGCGCCCTCTGATGCTGCCGCCG
GAAAGAGCTCGATGCACGGCACAACTCGTATTCTCTGGTGCCGAGGAGCCCCCAGGCCTTTCGTCTCTGCGTAAC
GGGGCGTCGAAACGAGCGGCGGTACAGACTACGAGCAACTCACTGCTATCTTTGGCAAAGATTTTTCAAGATGGC
TTGTCAAGCGGCAATGCAGACTTGTGCCTGCTCGTGCGACCATCATCGACTGTGGGCGATGTATTAGCACTATAC
TATCTCTCTCTGTCTCTACAGGAGAGTCCTTCGACCGCGAACAATATTGGTATCCTCTTGGCTGGCCTTCAGCAC
ACGGCTGCACTGCCAGCTGTGTTTTCTGGCAGAAATCTGATACAGGCTGCTATACCCGGTATCAGGCCAGGAAGC
GGAATGTCTTTTGCATTGGCATACTACAATTACGGCCTTGGTTTAGATCCCAAGCATGTCCATCTCCATACTAAT
CTAGGCAGTCTTTTAAAAGATATGGGTCTACTCGATCTCGCCATTTCAATGTATGAGCGCGCCGTCGCCTGCGAC
GGTTCTTTTGATATTGCCCTCACGAACCTTGCCAACGCGGTCAAAGATAAGGGTCGCATCAATGATGCCATAGTC
TACTACCGTCGTGCTGTTGACGCAAACCCTGCATTCTGCGAAGCAGTGTGTGGACTCTTTACAGCACTCAACTCA
GTCTGCAATTGGCAGGGTCGCGGTGGGGTTCTTTTGGAATGTGGAAAATACGACCGGTGGCATGTCGACGAGGAG
GGCGTCTTGCACGACGTGTTGGCGACGGGTCGCGGGAGCGGCCTGACACAACGCGTTGTTGACATAGTGGCGGAG
CAGCTCAGGGACGCATCCCTTTGGGGGCAGCATGCACTTGAAGCATCGACAAAGGCCACCCTGACACACGAGCTT
GAATGGCTTTGTGACGAGGGATGCTTCCGGCTAGAGGATGCACTGCAGCATTGGTCGGGCAGGCCATGGGAGGGC
TCGCGTTTGGTGCGACTGCTAGAGCGTGCGGCGCGAGTAACACAGCACCAATGGTACAAAGACGTGTACGTGTCA
CCGAGCAGAGGCAAAGGACGATCGTATTCTCGCCCCAGCTTGCCTCGGCATGTCTCGGTGCCGACGACACCGACG
GTACTCCCCTTTCACACCTTTACCTGCCCGCTCGCGGCCAGGGACATTCGAGCAATCTCTCAGCGCAATGCTCTG
CGAATAACGTGCTCGACGCTGCGGTCGTCGTGGCTGCCGGCCTCGGTGTATCCACCACCACGGCCGCCACAGCCG
CAGCTCAATGTCGGGTATGTCTCGTCAGACTTTAACAATCACCCCTTGGCTCATCTAATGCAATCCGTGTTTGGC
TTGCACAATTCAACCCGAGTCAAGGCCTTTTGCTACGCCACGACCAGCAGCGACAACTCGACGCACCGCCGTCAG
ATTGAGAGAGAGGCCCCCGTATTTCGAGAGGTTAGCAACTGGCCGTTGGACAAGGTTATTGACATTATTATTCAA
GACGAGATTCACATTCTGGTTAATCTCAACGGCTATACCCGCGGTGCACGTAATGAAATATTTGCTGCTAGACCC
GTACCTGTGCAGATGTCCTTTATGGGATTCGCGGGTAGCTTGGGTGCAGAGTGGTGTGACTATATTCTCGCGGAC
ACGACGGCTATCCCGCCCGAGACGCTGCGTCCGTGGAGAAGCAACACTAGCATCCAAGATGTCTTTGAGGACGGC
AACGAGGATGACGAGGACGGTGATTGGGTATACTCGGAGAACATCATATTCTGCCGGGACACATTTTTTTGCTGC
GATCATGCTCAGTCATGCGGCGCAAACGAGCGGGCAACGACGTGGGGACAGGAGCAACAGAGGAGATGGGCTATG
CGCAAGGCCATGTTTCCCGGCATGGCAGACGATGTGGTTATTCTCGCCAACTTTAACCAGCTGTACAAGATTGAG
CCAACGACATTTCGGTCGTGGCTACGCATCCTGACGCGGGTCCCCAAGGCTGTCTTGTGGTTGCTACGATTTCCC
GAGGCTGGGGAGCGCAATCTTCGAGTAACGGCAGAGGCATGGGCGGGGGCCGAGGTGGCTAGTCGGCTGTTTTTT
ACCGACGTGGCGGCCAAAAGCCATCACATCTCACGAGCACGCGTATGCGATTTATTCCTCGACACGCCCGAGTGC
AATGCGCATACTACGGCCGCTGACGTGCTGTGGTCAAGCACGCCACTACTTACACTGCCGCGATACCCCTACAAG
ATGTGTTCACGCATGGCTGCCTCGATTCTGCGTGGAGCGCTTCCGCGGTCGAGTGAGGGCAGACGGGTGGCTGAG
GAGCTGATTGTGAAGAACGAGGCTGAGTACGAGAGTGCAGCAGTCAGGCTAGCCAGCGGGCTAAGATATGCACCA
GTGGCACTAGACGAGCCCGCATCACCAAGTTACTGCGAGGGCCACGGACGCTTGGCCGAGATGCGCAGGCTACTA
TGGGATAGCAAGTGGAGCTGTGGACTGTTTGATACGCAACGCTGGGTCGACGATGTAGAGACTGCCTATCACGAG
GCATGGCGGAGATGGGTCCATGAAATTGGAGGTGACATTTATCTTTAG
Gene >OphauG2|562
ATGCCACAAAACTCGGAGACTCAGCAGTCGAGTGCTGGCGGCGCCCGACAACATCGGCGCTCGCGCCAGCACAGC
CAATTGCGCCGAAAAACTCCTAGTGGGGTTGTCGACGCGGGATATGAAGCGGTAGACCATGATGGAAATGCGCAA
GGCGCCGGCTCGCCCCCGTTAAAACAGTTCATCATTGCTGCTACGATTCCAGCGGCCGCGACGACGACCATGGGT
CATGGCGGCTCCAGACCTCTTGCCCGGCCTGTTCGCGCTTCTCGGTGTTCTGCGCCGCGGTCGACGAGGCCATGG
GATCCGTCGCCTGCGCACCAACATGTGTCCTCTTGGACTGACAAGGACGAAGCACTCTGGCTGAGCCTGGACCAA
TCCCAGTCATTGGCCCAGCCCACGGAGAACAAGATTTGGGCTGTTTACCGTCCACCACCTCCGGTAATGGAGCCA
TTTGCTCTTGGCTTGCAATCGTGTTGGTCCTCTCCCTTTCGGACAGCAGATTCAGGCAGTCAGGGGTATAGCCGC
TACCCAGCAAGCAACCCTTATTTGCCACTCAGCCACGGCGTCTACTCCCCTCCCCATAGCATCTGGCAGCTTCCA
GCACCAAGCAACTGGGCTGGCAGCAGCGCTGCAACTATTGATCGGCAGTCGGCATGCGCACGACGTTCCTTGACA
CGCGTGCGCCCGCAGCTCGGCACCAAAGAAAAGGCTCTGGCCTGTGGCTATCGAAGTTACATTGATTTGCTAGCC
TGTCTTCAAGCCAGTGGCCGGCCCGGTTCTGTCTGTCTCGGAGGCTCTAGGCTGTCGATATATCCTCGACCTCCC
AAACCAACTTTCGGGTCGTTACAGGCCGGCCCCCGCGAGAGCTCCATATTCCTCTCTTCGCTCTTTGATCTTGGC
CTCCCCACACAACGTCCTGGACAAGCACAGCTTGCGCCGAGCATCGATGCTACTCCCCAGCTGTCTTGTGCAGTC
TCCAATGCAGCTAGTCAACCAAAGCAGTCATTAGGTGTCTCATATTGGAGTCATGTACAGAATGAAACAACAGCT
TCGCCCATTTCAAGCGCTAAATCGGCCTTGGAGGTGGTCCATAATGTCTGCGAGCAGAGCGGCTGGCACTGGCTT
GATGGCATGTTGCTAGGGGGCTGTCTTTGCTATGGTCTAGGCCGTTACCAGGACGCCATACAATGGTTCTCGAGA
ATTCTCCACATAGACTCGAGGTAAAGGCCGATCCAGATGATGAACTGTCAAGTGGCCGTTCTCCATGTCTGACTC
ATTTTCGCAGTCATGTAGAAACCATGACCAACATGGCTGCTGCCCTTTATTGCCTTGATCGGCAGAGCGAAGCCG
AGCAGTTTTGGCTCGATGCTATTAAGCTACGCCCCAGTTACTTGGAAGCTGCCGAACACCTCGTGGGTCTTCTTT
ACAGGAAACGCGGCCCTGAAGCTGTACAGGTCGTATCGTATGTGCAGCGAGCCCTGAGGTTGCCAGACTCATCGC
TCACCACTCACCATGAGAGCCGTGTCGAGCGCAAGGACTATGGCTCAAGTGGCTATGCCTTGCCAGCGACGGAAA
ATGGTAGATTATTGGCTCTGGTTCATGCCAAGGGGACCATGCTCTACAATTTGAAACAAGTTACAAAGGCTGCTG
AAGCATTCGAAGAAGCCGTATTGATTGCTACTGGACGGCGCCTTGGCAAAATTGAACATATTATACGGCGTGTTC
AATGCGTGCTCTCTCCGCCCGGGATTTCGGACCCTGAGTCATGGCGCCCTCTGATGCTGCCGCCGGAAAGAGCTC
GATGCACGGCACAACTCGTATTCTCTGGTGCCGAGGAGCCCCCAGGCCTTTCGTCTCTGCGTAACGGGGCGTCGA
AACGAGCGGCGGTACAGACTACGAGCAACTCACTGCTATCTTTGGCAAAGATTTTTCAAGATGGCTTGTCAAGCG
GCAATGCAGACTTGTGCCTGCTCGTGCGACCATCATCGACTGTGGGCGATGTATTAGCACTATACTATCTCTCTC
TGTCTCTACAGGAGAGTCCTTCGACCGCGAACAATATTGGTATCCTCTTGGCTGGCCTTCAGCACACGGCTGCAC
TGCCAGCTGTGTTTTCTGGCAGAAATCTGATACAGGCTGCTATACCCGGTATCAGGCCAGGAAGCGGAATGTCTT
TTGCATTGGCATACTACAATTACGGCCTTGGTTTAGATCCCAAGCATGTCCATCTCCATACTAATCTAGGCAGTC
TTTTAAAAGATATGGGTCTACTCGATCTCGCCATTTCAATGTATGAGCGCGCCGTCGCCTGCGACGGTTCTTTTG
ATATTGCCCTCACGAACCTTGCCAACGCGGTCAAAGATAAGGGTCGCATCAATGATGCCATAGTCTACTACCGTC
GTGCTGTTGACGCAAACCCTGCATTCTGCGAAGCAGTGTGTGGACTCTTTACAGCACTCAACTCAGTCTGCAATT
GGCAGGGTCGCGGTGGGGTTCTTTTGGAATGTGGAAAATACGACCGGTGGCATGTCGACGAGGAGGGCGTCTTGC
ACGACGTGTTGGCGACGGGTCGCGGGAGCGGCCTGACACAACGCGTTGTTGACATAGTGGCGGAGCAGCTCAGGG
ACGCATCCCTTTGGGGGCAGCATGCACTTGAAGCATCGACAAAGGCCACCCTGACACACGAGCTTGAATGGCTTT
GTGACGAGGGATGCTTCCGGCTAGAGGATGCACTGCAGCATTGGTCGGGCAGGCCATGGGAGGGCTCGCGTTTGG
TGCGACTGCTAGAGCGTGCGGCGCGAGTAACACAGCACCAATGGTACAAAGACGTGTACGTGTCACCGAGCAGAG
GCAAAGGACGATCGTATTCTCGCCCCAGCTTGCCTCGGCATGTCTCGGTGCCGACGACACCGACGGTACTCCCCT
TTCACACCTTTACCTGCCCGCTCGCGGCCAGGGACATTCGAGCAATCTCTCAGCGCAATGCTCTGCGAATAACGT
GCTCGACGCTGCGGTCGTCGTGGCTGCCGGCCTCGGTGTATCCACCACCACGGCCGCCACAGCCGCAGCTCAATG
TCGGGTATGTCTCGTCAGACTTTAACAATCACCCCTTGGCTCATCTGTGAGTTGCTCGAGTCTTTGATGTCATGG
GTGAGCTTACAAGACTAATGAGTGTGCTGTCTGTCTCTGTGTGTGTGTGTGGTTGAATGGCCAGAATGCAATCCG
TGTTTGGCTTGCACAATTCAACCCGAGTCAAGGCCTTTTGCTACGCCACGACCAGCAGCGACAACTCGACGCACC
GCCGTCAGATTGAGAGAGAGGCCCCCGTATTTCGAGAGGTTAGCAACTGGCCGTTGGACAAGGTTATTGACATTA
TTATTCAAGACGAGATTCACATTCTGGTTAATCTCAACGGCTATACCCGCGGTGCACGTAATGAAATATTTGCTG
CTAGACCCGTACCTGTGCAGATGTCCTTTATGGGATTCGCGGGTAGCTTGGGTGCAGAGTGGTGTGACTATATTC
TCGCGGACACGACGGCTATCCCGCCCGAGACGCTGCGTCCGTGGAGAAGCAACACTAGCATCCAAGATGTCTTTG
AGGACGGCAACGAGGATGACGAGGACGGTGATTGGGTATACTCGGAGAACATCATATTCTGCCGGGACACATTTT
TTTGCTGCGATCATGCTCAGTCATGCGGCGCAAACGAGCGGGCAACGACGTGGGGACAGGAGCAACAGAGGAGAT
GGGCTATGCGCAAGGCCATGTTTCCCGGCATGGCAGACGATGTGGTTATTCTCGCCAACTTTAACCAGCTGTACA
AGGTGAGCCCAACTTTGAGGCTTGTCGTGCCGGTGCAAAAATGTGGCAACTGACTGTGTCATGTTGCAATCAGAT
TGAGCCAACGACATTTCGGTCGTGGCTACGCATCCTGACGCGGGTCCCCAAGGCTGTCTTGTGGTTGCTACGATT
TCCCGAGGCTGGGGAGCGCAATCTTCGAGTAACGGCAGAGGCATGGGCGGGGGCCGAGGTGGCTAGTCGGCTGTT
TTTTACCGACGTGGCGGCCAAAAGCCATCACATCTCACGAGCACGCGTATGCGATTTATTCCTCGACACGCCCGA
GTGCAATGCGCATACTACGGCCGCTGACGTGCTGTGGTCAAGCACGCCACTACTTACACTGCCGCGATACCCCTA
CAAGATGTGTTCACGCATGGCTGCCTCGATTCTGCGTGGAGCGCTTCCGCGGTCGAGTGAGGGCAGACGGGTGGC
TGAGGAGCTGATTGTGAAGAACGAGGCTGAGTACGAGAGTGCAGCAGTCAGGCTAGCCAGCGGGCTAAGATATGC
ACCAGTGGCACTAGACGAGCCCGCATCACCAAGTTACTGCGAGGGCCACGGACGCTTGGCCGAGATGCGCAGGCT
ACTATGGGATAGCAAGTGGAGCTGTGGACTGTTTGATACGCAACGCTGGGTCGACGATGTAGAGACTGCCTATCA
CGAGGCATGGCGGAGATGGGTCCATGAAATTGGAGGTGACATTTATCTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail