Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5611
Gene name
LocationContig_523:5502..6423
Strand-
Gene length (bp)921
Transcript length (bp)921
Coding sequence length (bp)921
Protein length (aa) 307

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1975
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5611 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3256
Ophiocordyceps camponoti-floridani Ophcf2|06662
Ophiocordyceps camponoti-rufipedis Ophun1|6034
Ophiocordyceps kimflemingae Ophio5|6204
Ophiocordyceps subramaniannii Hirsu2|217

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5611
MASLPSKRPRLSLKIKTTGLTNDAAPTALAPSHMAPGHHGRAATPHLASSYPDTPLTASLPCPRSHAGVMTATPP
LSAETDEPPAVASAFACCSEHLSRRQTNLEARSHDTPTAQAHASSDSEPAADARCSLPYTHPHSLHSILRNSPLF
CTTPSTASSRRHHHHHLLHQQHQHSLHQRTCKRVEYDSPLTQEITTNTYTKSHIDLLVEDMSSPNSPPSPQAAPW
ANGVQDAGQTPGPFDSLHRTTASRKRKRLVDKRRHWVWTIEPDNDDDAHDGPSNAQPPCSSHINQLDPISPSLPL
PAATSP*
Coding >OphauG2|5611
ATGGCATCGCTGCCCTCCAAGAGGCCGCGTCTGTCGCTCAAGATCAAGACGACGGGCCTGACCAACGACGCGGCT
CCCACTGCTCTCGCCCCCTCGCACATGGCGCCTGGCCACCATGGCCGCGCCGCCACGCCTCACCTGGCCTCGTCG
TACCCCGACACCCCGCTGACTGCCTCGCTGCCTTGTCCTCGGTCCCATGCTGGCGTCATGACGGCCACGCCCCCG
CTGTCGGCCGAGACTGACGAGCCGCCCGCCGTGGCCTCTGCCTTTGCATGTTGCTCCGAGCATCTCTCGCGCCGT
CAGACCAATCTGGAAGCTCGATCCCACGATACACCCACCGCCCAAGCCCATGCTTCATCCGACTCGGAGCCTGCT
GCTGATGCTCGCTGCTCGCTGCCCTACACGCACCCTCACAGCCTGCACAGCATCCTCCGCAACTCTCCCCTCTTT
TGTACAACACCGTCAACCGCCTCGTCACGCCGCCACCACCACCACCACCTCCTCCATCAACAGCACCAGCACTCA
CTCCACCAACGCACCTGCAAACGTGTCGAATACGACAGTCCCCTGACGCAGGAAATCACTACAAACACATACACA
AAGTCGCACATCGACCTCTTGGTCGAGGACATGTCGTCTCCTAATTCGCCGCCATCGCCCCAAGCTGCCCCATGG
GCCAACGGGGTGCAAGACGCCGGCCAAACTCCCGGCCCATTCGATAGCCTTCACCGCACCACGGCCTCCCGCAAG
CGCAAGAGATTAGTAGACAAGCGTCGCCATTGGGTTTGGACCATTGAACCCGACAACGACGACGACGCCCATGAC
GGCCCTTCCAATGCCCAGCCGCCATGCTCCTCCCACATCAATCAGCTCGACCCAATTAGCCCTAGCTTGCCTCTC
CCAGCCGCTACATCTCCCTGA
Transcript >OphauG2|5611
ATGGCATCGCTGCCCTCCAAGAGGCCGCGTCTGTCGCTCAAGATCAAGACGACGGGCCTGACCAACGACGCGGCT
CCCACTGCTCTCGCCCCCTCGCACATGGCGCCTGGCCACCATGGCCGCGCCGCCACGCCTCACCTGGCCTCGTCG
TACCCCGACACCCCGCTGACTGCCTCGCTGCCTTGTCCTCGGTCCCATGCTGGCGTCATGACGGCCACGCCCCCG
CTGTCGGCCGAGACTGACGAGCCGCCCGCCGTGGCCTCTGCCTTTGCATGTTGCTCCGAGCATCTCTCGCGCCGT
CAGACCAATCTGGAAGCTCGATCCCACGATACACCCACCGCCCAAGCCCATGCTTCATCCGACTCGGAGCCTGCT
GCTGATGCTCGCTGCTCGCTGCCCTACACGCACCCTCACAGCCTGCACAGCATCCTCCGCAACTCTCCCCTCTTT
TGTACAACACCGTCAACCGCCTCGTCACGCCGCCACCACCACCACCACCTCCTCCATCAACAGCACCAGCACTCA
CTCCACCAACGCACCTGCAAACGTGTCGAATACGACAGTCCCCTGACGCAGGAAATCACTACAAACACATACACA
AAGTCGCACATCGACCTCTTGGTCGAGGACATGTCGTCTCCTAATTCGCCGCCATCGCCCCAAGCTGCCCCATGG
GCCAACGGGGTGCAAGACGCCGGCCAAACTCCCGGCCCATTCGATAGCCTTCACCGCACCACGGCCTCCCGCAAG
CGCAAGAGATTAGTAGACAAGCGTCGCCATTGGGTTTGGACCATTGAACCCGACAACGACGACGACGCCCATGAC
GGCCCTTCCAATGCCCAGCCGCCATGCTCCTCCCACATCAATCAGCTCGACCCAATTAGCCCTAGCTTGCCTCTC
CCAGCCGCTACATCTCCCTGA
Gene >OphauG2|5611
ATGGCATCGCTGCCCTCCAAGAGGCCGCGTCTGTCGCTCAAGATCAAGACGACGGGCCTGACCAACGACGCGGCT
CCCACTGCTCTCGCCCCCTCGCACATGGCGCCTGGCCACCATGGCCGCGCCGCCACGCCTCACCTGGCCTCGTCG
TACCCCGACACCCCGCTGACTGCCTCGCTGCCTTGTCCTCGGTCCCATGCTGGCGTCATGACGGCCACGCCCCCG
CTGTCGGCCGAGACTGACGAGCCGCCCGCCGTGGCCTCTGCCTTTGCATGTTGCTCCGAGCATCTCTCGCGCCGT
CAGACCAATCTGGAAGCTCGATCCCACGATACACCCACCGCCCAAGCCCATGCTTCATCCGACTCGGAGCCTGCT
GCTGATGCTCGCTGCTCGCTGCCCTACACGCACCCTCACAGCCTGCACAGCATCCTCCGCAACTCTCCCCTCTTT
TGTACAACACCGTCAACCGCCTCGTCACGCCGCCACCACCACCACCACCTCCTCCATCAACAGCACCAGCACTCA
CTCCACCAACGCACCTGCAAACGTGTCGAATACGACAGTCCCCTGACGCAGGAAATCACTACAAACACATACACA
AAGTCGCACATCGACCTCTTGGTCGAGGACATGTCGTCTCCTAATTCGCCGCCATCGCCCCAAGCTGCCCCATGG
GCCAACGGGGTGCAAGACGCCGGCCAAACTCCCGGCCCATTCGATAGCCTTCACCGCACCACGGCCTCCCGCAAG
CGCAAGAGATTAGTAGACAAGCGTCGCCATTGGGTTTGGACCATTGAACCCGACAACGACGACGACGCCCATGAC
GGCCCTTCCAATGCCCAGCCGCCATGCTCCTCCCACATCAATCAGCTCGACCCAATTAGCCCTAGCTTGCCTCTC
CCAGCCGCTACATCTCCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail