Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5598
Gene name
LocationContig_520:3821..6492
Strand-
Gene length (bp)2671
Transcript length (bp)2610
Coding sequence length (bp)2610
Protein length (aa) 870

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04130 GCP_C_terminal Gamma tubulin complex component C-terminal 1.1E-97 508 855
PF17681 GCP_N_terminal Gamma tubulin complex component N-terminal 8.9E-79 202 505

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USQ2|ALP6_SCHPO Spindle pole body component alp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp6 PE=1 SV=2 69 867 1.0E-172
sp|P58854|GCP3_MOUSE Gamma-tubulin complex component 3 OS=Mus musculus GN=Tubgcp3 PE=1 SV=2 37 856 3.0E-105
sp|O73787|GCP3_XENLA Gamma-tubulin complex component 3 homolog OS=Xenopus laevis GN=tubgcp3 PE=1 SV=1 111 856 5.0E-103
sp|Q96CW5|GCP3_HUMAN Gamma-tubulin complex component 3 OS=Homo sapiens GN=TUBGCP3 PE=1 SV=2 182 856 4.0E-102
sp|Q9FG37|GACP3_ARATH Gamma-tubulin complex component 3 OS=Arabidopsis thaliana GN=GCP3 PE=1 SV=1 43 855 6.0E-90
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USQ2|ALP6_SCHPO Spindle pole body component alp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp6 PE=1 SV=2 69 867 1.0E-172
sp|P58854|GCP3_MOUSE Gamma-tubulin complex component 3 OS=Mus musculus GN=Tubgcp3 PE=1 SV=2 37 856 3.0E-105
sp|O73787|GCP3_XENLA Gamma-tubulin complex component 3 homolog OS=Xenopus laevis GN=tubgcp3 PE=1 SV=1 111 856 5.0E-103
sp|Q96CW5|GCP3_HUMAN Gamma-tubulin complex component 3 OS=Homo sapiens GN=TUBGCP3 PE=1 SV=2 182 856 4.0E-102
sp|Q9FG37|GACP3_ARATH Gamma-tubulin complex component 3 OS=Arabidopsis thaliana GN=GCP3 PE=1 SV=1 43 855 6.0E-90
sp|Q95ZG4|SPC98_DICDI Spindle pole body component 98 OS=Dictyostelium discoideum GN=spc98 PE=1 SV=2 198 721 4.0E-71
sp|Q9XYP8|GCP3_DROME Gamma-tubulin complex component 3 homolog OS=Drosophila melanogaster GN=l(1)dd4 PE=1 SV=2 262 714 2.0E-66
sp|P53540|SPC98_YEAST Spindle pole body component SPC98 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPC98 PE=1 SV=1 175 697 4.0E-43
sp|Q9BSJ2|GCP2_HUMAN Gamma-tubulin complex component 2 OS=Homo sapiens GN=TUBGCP2 PE=1 SV=2 194 720 7.0E-30
sp|Q921G8|GCP2_MOUSE Gamma-tubulin complex component 2 OS=Mus musculus GN=Tubgcp2 PE=1 SV=2 194 720 1.0E-29
sp|Q5R5J6|GCP2_PONAB Gamma-tubulin complex component 2 OS=Pongo abelii GN=TUBGCP2 PE=2 SV=1 194 720 2.0E-29
sp|Q9C5H9|GACP2_ARATH Gamma-tubulin complex component 2 OS=Arabidopsis thaliana GN=GCP2 PE=1 SV=1 357 720 4.0E-25
sp|Q9XYP7|GCP2_DROME Gamma-tubulin complex component 2 homolog OS=Drosophila melanogaster GN=Grip84 PE=1 SV=2 365 720 2.0E-22
sp|Q9M350|GACP4_ARATH Gamma-tubulin complex component 4 OS=Arabidopsis thaliana GN=GCP4 PE=2 SV=2 342 720 3.0E-18
sp|Q9Y705|ALP4_SCHPO Spindle pole body component alp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp4 PE=1 SV=1 213 559 5.0E-13
sp|Q96RT7|GCP6_HUMAN Gamma-tubulin complex component 6 OS=Homo sapiens GN=TUBGCP6 PE=1 SV=3 505 723 3.0E-12
sp|Q9SC88|GCP4_MEDTR Gamma-tubulin complex component 4 homolog OS=Medicago truncatula GN=85P PE=2 SV=1 482 720 3.0E-11
sp|Q95ZG3|SPC97_DICDI Spindle pole body component 97 OS=Dictyostelium discoideum GN=spc97 PE=2 SV=2 262 562 6.0E-11
sp|Q96RT8|GCP5_HUMAN Gamma-tubulin complex component 5 OS=Homo sapiens GN=TUBGCP5 PE=1 SV=1 487 723 3.0E-10
sp|Q95K09|GCP5_MACFA Gamma-tubulin complex component 5 (Fragment) OS=Macaca fascicularis GN=TUBGCP5 PE=2 SV=2 487 723 8.0E-10
sp|Q8BKN5|GCP5_MOUSE Gamma-tubulin complex component 5 OS=Mus musculus GN=Tubgcp5 PE=2 SV=2 487 723 3.0E-09
sp|Q95ZG3|SPC97_DICDI Spindle pole body component 97 OS=Dictyostelium discoideum GN=spc97 PE=2 SV=2 586 720 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0043015 gamma-tubulin binding Yes
GO:0003674 molecular_function No
GO:0005515 protein binding No
GO:0015631 tubulin binding No
GO:0008092 cytoskeletal protein binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3514
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5598 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7722
Ophiocordyceps camponoti-floridani Ophcf2|00958
Ophiocordyceps camponoti-rufipedis Ophun1|6158
Ophiocordyceps kimflemingae Ophio5|1037
Ophiocordyceps subramaniannii Hirsu2|6733

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5598
MPPDRIANAIDSLIAHLVPGSPDDDAQAAEARHNDCFQLVRSIIDSPAHPVISPDVNHASDLIKRKLVQNNPGQA
LHYSNLYTQLLCLPVLQHKWAILYLLYQLADSPDPNEPIPPSPIKPSAPNYREAIKRQSRQRFKPPSDEEELKEA
FQPDGLRKMPAEQKRDSLQQPQDGPRRTGAPTPTRMGSNTFTELVPSETTLVRSLPFTLQGISSESLSFTASDSL
KLPPTLPLPLIGILHTLAEPSLLYRHLEAFCHTQPQGLLGQSLRSAMSNQLRSYLGLIATIESQMRGALANVDQQ
APASNSMAKAGITLKSCVVWTRDATLGLRLMSHIAEESKSRKGGQLISLIHGFLSYGDALVAGFAEQLLTSFTKP
FYDMLRHWIYDGELVDPYVEFFVREQTHGGAQEEAKGKKKGSGNLWEDKYEIDESMVPSIMTRDFAQKVFLIGKS
LNFIRHSCGDWAWVEQYSRAASKELRYGDTATLEGWIDEAYKTTMKRLMELMADKFNLFDHLQALKSYILLGQGD
FITLLMESLAGNLDGPAGAQYRHTLTAQLEHAIRGSSAQYDSPEVLRRLDARMLQLSHGDIGWDCFTLEYKIDTP
VDVVVTEWGNRQYLKVFNFLWRIKRVEFALLTTWRKCMTGSRGVLQSPDAQVMQTWETTRGVLAEMKHFVGQLQN
YIEFEVIKPSWEELQQRIGKEDCTLDDLINAHGRYLDDITHKGLLGAKQRRPQHRGGAGPAEGHDDRTSYLAQLS
DILRFMLNYREAVDGLYSWSVSDFTRRQEADVRGATGGPLVALEDSALGPAGEAVVSEFPALQERLRQLGASFRT
RVQILLGDLAYQPDVDMRFLGVAMNYNDVYQPARRKSKTTTTKA*
Coding >OphauG2|5598
ATGCCTCCCGACCGCATTGCAAATGCCATCGATAGCTTGATAGCCCACCTGGTGCCCGGCAGCCCAGACGACGAT
GCCCAAGCTGCCGAGGCTCGACACAATGACTGCTTCCAGCTCGTCAGGTCCATCATTGACAGCCCTGCGCATCCA
GTCATCTCGCCCGACGTCAATCACGCCTCGGACCTCATCAAGCGCAAGCTCGTTCAAAACAATCCTGGCCAGGCA
CTCCACTACTCCAACCTCTACACCCAATTGCTCTGCCTGCCCGTGCTCCAGCACAAATGGGCCATTCTATATCTC
TTGTACCAGCTTGCAGACTCTCCAGACCCCAACGAGCCCATACCGCCCAGCCCTATCAAGCCCTCGGCTCCCAAC
TACCGCGAAGCCATCAAGAGACAGAGCCGCCAGCGCTTCAAGCCTCCCAGCGATGAGGAAGAGCTCAAGGAGGCC
TTTCAGCCCGACGGGCTGCGCAAGATGCCCGCCGAGCAGAAGCGCGACAGTCTACAGCAACCGCAGGATGGCCCC
AGGCGAACCGGGGCGCCCACGCCCACTCGTATGGGCAGCAATACATTTACAGAACTTGTTCCCTCAGAGACTACT
CTTGTGCGGAGTCTTCCATTTACGCTGCAGGGAATCTCATCGGAATCACTGTCTTTTACCGCCTCTGATAGCTTG
AAGCTTCCACCCACTCTGCCATTGCCCCTCATCGGCATCTTGCATACCTTGGCTGAGCCTTCACTGCTATACCGC
CACCTCGAAGCCTTTTGCCACACACAGCCTCAGGGCTTGTTGGGCCAGAGTCTGCGGTCTGCCATGAGCAACCAA
CTGCGGTCTTACCTGGGCCTGATTGCCACAATTGAGAGCCAGATGCGCGGAGCGCTGGCCAACGTCGACCAACAG
GCTCCTGCTAGCAACAGCATGGCAAAGGCCGGCATCACTCTCAAGAGCTGTGTTGTGTGGACGCGGGACGCAACG
CTAGGCCTGCGACTAATGAGCCACATTGCAGAAGAGTCCAAGAGTCGAAAGGGCGGACAGCTCATCTCACTCATC
CATGGCTTCTTGTCGTACGGAGACGCCTTGGTGGCAGGATTTGCCGAGCAGCTGCTGACCAGCTTCACCAAGCCC
TTTTACGACATGCTGCGGCACTGGATCTACGACGGCGAGCTGGTGGATCCCTATGTCGAGTTTTTTGTGCGAGAG
CAGACGCATGGAGGCGCCCAAGAGGAGGCCAAGGGCAAAAAGAAGGGGTCGGGGAATTTATGGGAAGACAAGTAC
GAGATTGACGAGTCCATGGTGCCCAGCATCATGACGCGCGACTTTGCGCAAAAGGTGTTTTTGATTGGCAAATCG
CTCAACTTTATCCGGCACAGCTGTGGCGACTGGGCATGGGTGGAGCAGTACTCGCGCGCGGCGTCCAAGGAGCTT
CGGTACGGCGACACGGCCACGTTGGAAGGCTGGATTGACGAGGCATACAAGACGACTATGAAGCGTCTGATGGAG
CTCATGGCGGACAAGTTCAACCTCTTTGATCACCTGCAGGCTCTCAAGAGCTACATTTTGCTGGGGCAGGGCGAC
TTTATCACGTTGCTCATGGAGTCGCTGGCGGGCAACCTTGACGGGCCGGCCGGCGCACAGTATCGCCATACGCTG
ACGGCGCAGCTGGAGCACGCCATTCGCGGGTCCAGCGCCCAGTACGACTCGCCCGAGGTGCTGCGACGGCTGGAC
GCGCGCATGCTGCAGCTCTCGCACGGCGACATTGGCTGGGACTGCTTCACGCTCGAGTACAAGATTGACACGCCT
GTGGACGTGGTGGTGACGGAATGGGGCAACCGGCAGTATCTCAAAGTTTTCAACTTTTTGTGGCGCATCAAGCGC
GTCGAGTTTGCCCTGCTGACGACGTGGCGCAAGTGCATGACGGGATCGCGCGGCGTGCTGCAAAGCCCCGACGCC
CAGGTGATGCAGACGTGGGAGACGACGCGAGGCGTCCTGGCCGAGATGAAGCACTTTGTCGGCCAGCTGCAAAAC
TATATTGAATTCGAGGTGATTAAGCCGTCGTGGGAGGAGCTGCAGCAGAGGATAGGCAAGGAGGACTGCACTCTG
GACGATCTGATCAATGCGCATGGCAGATATCTCGACGATATTACTCACAAGGGGCTGCTGGGGGCCAAGCAGCGG
CGGCCGCAGCACCGAGGGGGCGCTGGGCCGGCCGAGGGCCACGACGACAGGACGTCGTATCTGGCGCAGCTGAGC
GACATTTTGCGCTTCATGCTAAACTACCGCGAGGCGGTTGACGGGCTGTATAGCTGGAGCGTGTCTGACTTTACA
AGACGCCAAGAGGCTGATGTACGAGGCGCGACTGGCGGGCCACTTGTCGCGCTCGAGGACAGTGCGCTGGGGCCG
GCGGGCGAGGCGGTGGTGTCTGAGTTTCCGGCGCTGCAGGAGCGGCTGCGGCAGCTGGGGGCGTCGTTTCGAACG
CGTGTGCAGATTTTGCTGGGCGACTTGGCGTATCAGCCAGATGTGGACATGCGCTTCTTGGGAGTGGCCATGAAT
TACAACGACGTCTATCAACCGGCGCGGCGAAAGAGCAAGACGACGACGACCAAGGCTTGA
Transcript >OphauG2|5598
ATGCCTCCCGACCGCATTGCAAATGCCATCGATAGCTTGATAGCCCACCTGGTGCCCGGCAGCCCAGACGACGAT
GCCCAAGCTGCCGAGGCTCGACACAATGACTGCTTCCAGCTCGTCAGGTCCATCATTGACAGCCCTGCGCATCCA
GTCATCTCGCCCGACGTCAATCACGCCTCGGACCTCATCAAGCGCAAGCTCGTTCAAAACAATCCTGGCCAGGCA
CTCCACTACTCCAACCTCTACACCCAATTGCTCTGCCTGCCCGTGCTCCAGCACAAATGGGCCATTCTATATCTC
TTGTACCAGCTTGCAGACTCTCCAGACCCCAACGAGCCCATACCGCCCAGCCCTATCAAGCCCTCGGCTCCCAAC
TACCGCGAAGCCATCAAGAGACAGAGCCGCCAGCGCTTCAAGCCTCCCAGCGATGAGGAAGAGCTCAAGGAGGCC
TTTCAGCCCGACGGGCTGCGCAAGATGCCCGCCGAGCAGAAGCGCGACAGTCTACAGCAACCGCAGGATGGCCCC
AGGCGAACCGGGGCGCCCACGCCCACTCGTATGGGCAGCAATACATTTACAGAACTTGTTCCCTCAGAGACTACT
CTTGTGCGGAGTCTTCCATTTACGCTGCAGGGAATCTCATCGGAATCACTGTCTTTTACCGCCTCTGATAGCTTG
AAGCTTCCACCCACTCTGCCATTGCCCCTCATCGGCATCTTGCATACCTTGGCTGAGCCTTCACTGCTATACCGC
CACCTCGAAGCCTTTTGCCACACACAGCCTCAGGGCTTGTTGGGCCAGAGTCTGCGGTCTGCCATGAGCAACCAA
CTGCGGTCTTACCTGGGCCTGATTGCCACAATTGAGAGCCAGATGCGCGGAGCGCTGGCCAACGTCGACCAACAG
GCTCCTGCTAGCAACAGCATGGCAAAGGCCGGCATCACTCTCAAGAGCTGTGTTGTGTGGACGCGGGACGCAACG
CTAGGCCTGCGACTAATGAGCCACATTGCAGAAGAGTCCAAGAGTCGAAAGGGCGGACAGCTCATCTCACTCATC
CATGGCTTCTTGTCGTACGGAGACGCCTTGGTGGCAGGATTTGCCGAGCAGCTGCTGACCAGCTTCACCAAGCCC
TTTTACGACATGCTGCGGCACTGGATCTACGACGGCGAGCTGGTGGATCCCTATGTCGAGTTTTTTGTGCGAGAG
CAGACGCATGGAGGCGCCCAAGAGGAGGCCAAGGGCAAAAAGAAGGGGTCGGGGAATTTATGGGAAGACAAGTAC
GAGATTGACGAGTCCATGGTGCCCAGCATCATGACGCGCGACTTTGCGCAAAAGGTGTTTTTGATTGGCAAATCG
CTCAACTTTATCCGGCACAGCTGTGGCGACTGGGCATGGGTGGAGCAGTACTCGCGCGCGGCGTCCAAGGAGCTT
CGGTACGGCGACACGGCCACGTTGGAAGGCTGGATTGACGAGGCATACAAGACGACTATGAAGCGTCTGATGGAG
CTCATGGCGGACAAGTTCAACCTCTTTGATCACCTGCAGGCTCTCAAGAGCTACATTTTGCTGGGGCAGGGCGAC
TTTATCACGTTGCTCATGGAGTCGCTGGCGGGCAACCTTGACGGGCCGGCCGGCGCACAGTATCGCCATACGCTG
ACGGCGCAGCTGGAGCACGCCATTCGCGGGTCCAGCGCCCAGTACGACTCGCCCGAGGTGCTGCGACGGCTGGAC
GCGCGCATGCTGCAGCTCTCGCACGGCGACATTGGCTGGGACTGCTTCACGCTCGAGTACAAGATTGACACGCCT
GTGGACGTGGTGGTGACGGAATGGGGCAACCGGCAGTATCTCAAAGTTTTCAACTTTTTGTGGCGCATCAAGCGC
GTCGAGTTTGCCCTGCTGACGACGTGGCGCAAGTGCATGACGGGATCGCGCGGCGTGCTGCAAAGCCCCGACGCC
CAGGTGATGCAGACGTGGGAGACGACGCGAGGCGTCCTGGCCGAGATGAAGCACTTTGTCGGCCAGCTGCAAAAC
TATATTGAATTCGAGGTGATTAAGCCGTCGTGGGAGGAGCTGCAGCAGAGGATAGGCAAGGAGGACTGCACTCTG
GACGATCTGATCAATGCGCATGGCAGATATCTCGACGATATTACTCACAAGGGGCTGCTGGGGGCCAAGCAGCGG
CGGCCGCAGCACCGAGGGGGCGCTGGGCCGGCCGAGGGCCACGACGACAGGACGTCGTATCTGGCGCAGCTGAGC
GACATTTTGCGCTTCATGCTAAACTACCGCGAGGCGGTTGACGGGCTGTATAGCTGGAGCGTGTCTGACTTTACA
AGACGCCAAGAGGCTGATGTACGAGGCGCGACTGGCGGGCCACTTGTCGCGCTCGAGGACAGTGCGCTGGGGCCG
GCGGGCGAGGCGGTGGTGTCTGAGTTTCCGGCGCTGCAGGAGCGGCTGCGGCAGCTGGGGGCGTCGTTTCGAACG
CGTGTGCAGATTTTGCTGGGCGACTTGGCGTATCAGCCAGATGTGGACATGCGCTTCTTGGGAGTGGCCATGAAT
TACAACGACGTCTATCAACCGGCGCGGCGAAAGAGCAAGACGACGACGACCAAGGCTTGA
Gene >OphauG2|5598
ATGCCTCCCGACCGCATTGCAAATGCCATCGATAGCTTGATAGCCCACCTGGTGCCCGGCAGCCCAGACGACGAT
GCCCAAGCTGCCGAGGCTCGACACAATGACTGCTTCCAGCTCGTCAGGTCCATCATTGACAGGTGAAGCCTCTTA
TCCTCGCCTTGTCTGCTTGCCGTCTTGTCCATCTAACGTTGCATCAAGCCCTGCGCATCCAGTCATCTCGCCCGA
CGTCAATCACGCCTCGGACCTCATCAAGCGCAAGCTCGTTCAAAACAATCCTGGCCAGGCACTCCACTACTCCAA
CCTCTACACCCAATTGCTCTGCCTGCCCGTGCTCCAGCACAAATGGGCCATTCTATATCTCTTGTACCAGCTTGC
AGACTCTCCAGACCCCAACGAGCCCATACCGCCCAGCCCTATCAAGCCCTCGGCTCCCAACTACCGCGAAGCCAT
CAAGAGACAGAGCCGCCAGCGCTTCAAGCCTCCCAGCGATGAGGAAGAGCTCAAGGAGGCCTTTCAGCCCGACGG
GCTGCGCAAGATGCCCGCCGAGCAGAAGCGCGACAGTCTACAGCAACCGCAGGATGGCCCCAGGCGAACCGGGGC
GCCCACGCCCACTCGTATGGGCAGCAATACATTTACAGAACTTGTTCCCTCAGAGACTACTCTTGTGCGGAGTCT
TCCATTTACGCTGCAGGGAATCTCATCGGAATCACTGTCTTTTACCGCCTCTGATAGCTTGAAGCTTCCACCCAC
TCTGCCATTGCCCCTCATCGGCATCTTGCATACCTTGGCTGAGCCTTCACTGCTATACCGCCACCTCGAAGCCTT
TTGCCACACACAGCCTCAGGGCTTGTTGGGCCAGAGTCTGCGGTCTGCCATGAGCAACCAACTGCGGTCTTACCT
GGGCCTGATTGCCACAATTGAGAGCCAGATGCGCGGAGCGCTGGCCAACGTCGACCAACAGGCTCCTGCTAGCAA
CAGCATGGCAAAGGCCGGCATCACTCTCAAGAGCTGTGTTGTGTGGACGCGGGACGCAACGCTAGGCCTGCGACT
AATGAGCCACATTGCAGAAGAGTCCAAGAGTCGAAAGGGCGGACAGCTCATCTCACTCATCCATGGCTTCTTGTC
GTACGGAGACGCCTTGGTGGCAGGATTTGCCGAGCAGCTGCTGACCAGCTTCACCAAGCCCTTTTACGACATGCT
GCGGCACTGGATCTACGACGGCGAGCTGGTGGATCCCTATGTCGAGTTTTTTGTGCGAGAGCAGACGCATGGAGG
CGCCCAAGAGGAGGCCAAGGGCAAAAAGAAGGGGTCGGGGAATTTATGGGAAGACAAGTACGAGATTGACGAGTC
CATGGTGCCCAGCATCATGACGCGCGACTTTGCGCAAAAGGTGTTTTTGATTGGCAAATCGCTCAACTTTATCCG
GCACAGCTGTGGCGACTGGGCATGGGTGGAGCAGTACTCGCGCGCGGCGTCCAAGGAGCTTCGGTACGGCGACAC
GGCCACGTTGGAAGGCTGGATTGACGAGGCATACAAGACGACTATGAAGCGTCTGATGGAGCTCATGGCGGACAA
GTTCAACCTCTTTGATCACCTGCAGGCTCTCAAGAGCTACATTTTGCTGGGGCAGGGCGACTTTATCACGTTGCT
CATGGAGTCGCTGGCGGGCAACCTTGACGGGCCGGCCGGCGCACAGTATCGCCATACGCTGACGGCGCAGCTGGA
GCACGCCATTCGCGGGTCCAGCGCCCAGTACGACTCGCCCGAGGTGCTGCGACGGCTGGACGCGCGCATGCTGCA
GCTCTCGCACGGCGACATTGGCTGGGACTGCTTCACGCTCGAGTACAAGATTGACACGCCTGTGGACGTGGTGGT
GACGGAATGGGGCAACCGGCAGTATCTCAAAGTTTTCAACTTTTTGTGGCGCATCAAGCGCGTCGAGTTTGCCCT
GCTGACGACGTGGCGCAAGTGCATGACGGGATCGCGCGGCGTGCTGCAAAGCCCCGACGCCCAGGTGATGCAGAC
GTGGGAGACGACGCGAGGCGTCCTGGCCGAGATGAAGCACTTTGTCGGCCAGCTGCAAAACTATATTGAATTCGA
GGTGATTAAGCCGTCGTGGGAGGAGCTGCAGCAGAGGATAGGCAAGGAGGACTGCACTCTGGACGATCTGATCAA
TGCGCATGGCAGATATCTCGACGATATTACTCACAAGGGGCTGCTGGGGGCCAAGCAGCGGCGGCCGCAGCACCG
AGGGGGCGCTGGGCCGGCCGAGGGCCACGACGACAGGACGTCGTATCTGGCGCAGCTGAGCGACATTTTGCGCTT
CATGCTAAACTACCGCGAGGCGGTTGACGGGCTGTATAGCTGGAGCGTGTCTGACTTTACAAGACGCCAAGAGGC
TGATGTACGAGGCGCGACTGGCGGGCCACTTGTCGCGCTCGAGGACAGTGCGCTGGGGCCGGCGGGCGAGGCGGT
GGTGTCTGAGTTTCCGGCGCTGCAGGAGCGGCTGCGGCAGCTGGGGGCGTCGTTTCGAACGCGTGTGCAGATTTT
GCTGGGCGACTTGGCGTATCAGCCAGATGTGGACATGCGCTTCTTGGGAGTGGCCATGAATTACAACGACGTCTA
TCAACCGGCGCGGCGAAAGAGCAAGACGACGACGACCAAGGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail