Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5588
Gene name
LocationContig_52:18894..19367
Strand-
Gene length (bp)473
Transcript length (bp)411
Coding sequence length (bp)411
Protein length (aa) 137

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08555 FAM32A FAM32A 1.6E-14 5 93

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q92363|YEJL_SCHPO Uncharacterized protein C31G5.21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=N118 PE=4 SV=1 79 136 1.0E-07

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1831
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5588 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1030
Ophiocordyceps camponoti-floridani Ophcf2|06763
Ophiocordyceps camponoti-rufipedis Ophun1|5759
Ophiocordyceps kimflemingae Ophio5|1412
Ophiocordyceps subramaniannii Hirsu2|182

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5588
MPSDDYAAVGGGALKLKGAKVHKKGTKKKNKAKSSLEQALSVHQASESRPDPNEKPNEKHDGVNDEARDVLEPPG
VLKTESERRHDEARKKRLLDMTQATGLRPELLKTHKERVEELNTYLSKLSEHHDMPKIGPG*
Coding >OphauG2|5588
ATGCCCTCAGACGACTATGCAGCCGTGGGCGGCGGTGCCCTGAAGCTCAAGGGCGCCAAGGTGCATAAAAAGGGC
ACCAAGAAGAAGAACAAAGCCAAGAGCAGCCTTGAACAGGCGCTCTCTGTCCATCAAGCCAGCGAGTCCCGCCCC
GACCCCAACGAGAAACCTAACGAGAAACACGACGGCGTCAATGACGAAGCCCGTGATGTCTTGGAGCCACCGGGC
GTGCTCAAGACCGAGTCGGAGCGACGCCACGACGAGGCCAGGAAAAAGCGACTGCTTGACATGACCCAGGCAACC
GGCCTGAGGCCCGAGCTGCTCAAGACACACAAGGAGCGCGTTGAGGAGCTCAACACATACCTATCCAAACTCAGC
GAACATCATGACATGCCCAAGATTGGCCCCGGCTGA
Transcript >OphauG2|5588
ATGCCCTCAGACGACTATGCAGCCGTGGGCGGCGGTGCCCTGAAGCTCAAGGGCGCCAAGGTGCATAAAAAGGGC
ACCAAGAAGAAGAACAAAGCCAAGAGCAGCCTTGAACAGGCGCTCTCTGTCCATCAAGCCAGCGAGTCCCGCCCC
GACCCCAACGAGAAACCTAACGAGAAACACGACGGCGTCAATGACGAAGCCCGTGATGTCTTGGAGCCACCGGGC
GTGCTCAAGACCGAGTCGGAGCGACGCCACGACGAGGCCAGGAAAAAGCGACTGCTTGACATGACCCAGGCAACC
GGCCTGAGGCCCGAGCTGCTCAAGACACACAAGGAGCGCGTTGAGGAGCTCAACACATACCTATCCAAACTCAGC
GAACATCATGACATGCCCAAGATTGGCCCCGGCTGA
Gene >OphauG2|5588
ATGCCCTCAGACGACTATGCAGCCGTGGGCGGCGGTGCCCTGAAGCTCAAGGGCGCCAAGGTGCATAAAAAGGGC
ACCAAGAAGAAGAACAAAGCCAAGAGCAGCCTTGAACAGGCGCTCTCTGTCCATCAAGCCAGCGAGTCCCGCCCC
GACCCCAACGAGAAACCTAACGAGAAACACGACGGCGTCAATGACGAAGCCCGTGATGTCTTGGAGCCACCGGGC
GTGCTCAAGACCGAGTCGGAGCGACGCCACGACGAGGCCAGGAAAAAGCGAGTGAGTGTGCCTCGCTTCACCCTG
CGACATGCCCTGTCAAACTGACACCCCATGGCACTCAGCTGCTTGACATGACCCAGGCAACCGGCCTGAGGCCCG
AGCTGCTCAAGACACACAAGGAGCGCGTTGAGGAGCTCAACACATACCTATCCAAACTCAGCGAACATCATGACA
TGCCCAAGATTGGCCCCGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail