Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5584
Gene name
LocationContig_52:14327..14918
Strand-
Gene length (bp)591
Transcript length (bp)591
Coding sequence length (bp)591
Protein length (aa) 197

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup393
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5583
Ophiocordyceps australis 1348a (Ghana) OphauG2|5584 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1028
Ophiocordyceps camponoti-floridani Ophcf2|06761
Ophiocordyceps camponoti-rufipedis Ophun1|5757
Ophiocordyceps kimflemingae Ophio5|1410
Ophiocordyceps subramaniannii Hirsu2|174
Ophiocordyceps subramaniannii Hirsu2|175

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5584
MPEHSAADSSPHDSELDPLPLSRSPHPYHHHSFDLQQPSECIAPNGHCPPPQTGPLDPSQTAFPALSKESSLASD
SGTEADDEHFLKGLPAPRAKLHKGLRGRTETSSGISTPIASPSILQHQAHVAAKQDIDKQRQSDSLRRTRVLLRR
ITETALVFSLGLMVATNRRASPLLKLWRKGMLSTLQLKFLSDQSQI*
Coding >OphauG2|5584
ATGCCAGAGCATTCTGCCGCCGACTCGTCTCCCCATGACTCGGAGCTGGATCCTCTTCCACTGAGCCGATCTCCT
CATCCATACCACCACCACAGCTTCGACCTGCAGCAGCCATCTGAATGCATCGCCCCAAATGGCCATTGCCCACCG
CCGCAGACTGGCCCCTTGGACCCATCTCAGACTGCTTTCCCCGCCCTGTCCAAGGAGTCGTCTCTGGCCAGCGAT
AGCGGCACTGAAGCCGATGACGAGCATTTCCTCAAGGGACTTCCGGCGCCAAGGGCTAAGCTGCACAAGGGTCTT
CGTGGGCGCACCGAAACTTCGTCAGGCATCTCCACTCCTATAGCCTCGCCCAGCATCCTTCAACATCAAGCACAC
GTCGCCGCCAAACAAGACATCGACAAACAACGCCAGTCGGACAGCTTGCGCCGAACAAGAGTACTTTTGCGTCGA
ATAACCGAAACGGCCCTCGTTTTCTCCCTCGGTCTCATGGTGGCGACGAATCGTCGAGCATCACCGCTTCTCAAG
CTTTGGCGCAAAGGTATGCTGAGCACCTTGCAACTCAAATTCCTCTCTGATCAATCGCAGATATAA
Transcript >OphauG2|5584
ATGCCAGAGCATTCTGCCGCCGACTCGTCTCCCCATGACTCGGAGCTGGATCCTCTTCCACTGAGCCGATCTCCT
CATCCATACCACCACCACAGCTTCGACCTGCAGCAGCCATCTGAATGCATCGCCCCAAATGGCCATTGCCCACCG
CCGCAGACTGGCCCCTTGGACCCATCTCAGACTGCTTTCCCCGCCCTGTCCAAGGAGTCGTCTCTGGCCAGCGAT
AGCGGCACTGAAGCCGATGACGAGCATTTCCTCAAGGGACTTCCGGCGCCAAGGGCTAAGCTGCACAAGGGTCTT
CGTGGGCGCACCGAAACTTCGTCAGGCATCTCCACTCCTATAGCCTCGCCCAGCATCCTTCAACATCAAGCACAC
GTCGCCGCCAAACAAGACATCGACAAACAACGCCAGTCGGACAGCTTGCGCCGAACAAGAGTACTTTTGCGTCGA
ATAACCGAAACGGCCCTCGTTTTCTCCCTCGGTCTCATGGTGGCGACGAATCGTCGAGCATCACCGCTTCTCAAG
CTTTGGCGCAAAGGTATGCTGAGCACCTTGCAACTCAAATTCCTCTCTGATCAATCGCAGATATAA
Gene >OphauG2|5584
ATGCCAGAGCATTCTGCCGCCGACTCGTCTCCCCATGACTCGGAGCTGGATCCTCTTCCACTGAGCCGATCTCCT
CATCCATACCACCACCACAGCTTCGACCTGCAGCAGCCATCTGAATGCATCGCCCCAAATGGCCATTGCCCACCG
CCGCAGACTGGCCCCTTGGACCCATCTCAGACTGCTTTCCCCGCCCTGTCCAAGGAGTCGTCTCTGGCCAGCGAT
AGCGGCACTGAAGCCGATGACGAGCATTTCCTCAAGGGACTTCCGGCGCCAAGGGCTAAGCTGCACAAGGGTCTT
CGTGGGCGCACCGAAACTTCGTCAGGCATCTCCACTCCTATAGCCTCGCCCAGCATCCTTCAACATCAAGCACAC
GTCGCCGCCAAACAAGACATCGACAAACAACGCCAGTCGGACAGCTTGCGCCGAACAAGAGTACTTTTGCGTCGA
ATAACCGAAACGGCCCTCGTTTTCTCCCTCGGTCTCATGGTGGCGACGAATCGTCGAGCATCACCGCTTCTCAAG
CTTTGGCGCAAAGGTATGCTGAGCACCTTGCAACTCAAATTCCTCTCTGATCAATCGCAGATATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail