Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5563
Gene name
LocationContig_518:4101..5548
Strand-
Gene length (bp)1447
Transcript length (bp)1389
Coding sequence length (bp)1389
Protein length (aa) 463

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19270 FBO_C F-box only protein C-terminal region 6.0E-20 273 412

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74531|POF7_SCHPO F-box protein pof7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof7 PE=1 SV=2 70 458 1.0E-26
sp|Q12347|HRT3_YEAST F-box protein HRT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRT3 PE=1 SV=1 72 458 2.0E-21
sp|Q3ZBT2|FBX9_BOVIN F-box only protein 9 OS=Bos taurus GN=FBXO9 PE=2 SV=2 2 458 3.0E-20
sp|Q8BK06|FBX9_MOUSE F-box only protein 9 OS=Mus musculus GN=Fbxo9 PE=1 SV=1 5 458 3.0E-19
sp|Q9UK97|FBX9_HUMAN F-box only protein 9 OS=Homo sapiens GN=FBXO9 PE=1 SV=1 3 344 2.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74531|POF7_SCHPO F-box protein pof7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof7 PE=1 SV=2 70 458 1.0E-26
sp|Q12347|HRT3_YEAST F-box protein HRT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRT3 PE=1 SV=1 72 458 2.0E-21
sp|Q3ZBT2|FBX9_BOVIN F-box only protein 9 OS=Bos taurus GN=FBXO9 PE=2 SV=2 2 458 3.0E-20
sp|Q8BK06|FBX9_MOUSE F-box only protein 9 OS=Mus musculus GN=Fbxo9 PE=1 SV=1 5 458 3.0E-19
sp|Q9UK97|FBX9_HUMAN F-box only protein 9 OS=Homo sapiens GN=FBXO9 PE=1 SV=1 3 344 2.0E-18
sp|F6Y9J3|FBX9_XENTR F-box only protein 9 OS=Xenopus tropicalis GN=fbxo9 PE=3 SV=1 3 384 2.0E-18
sp|Q5U2X1|FBX9_RAT F-box only protein 9 OS=Rattus norvegicus GN=Fbxo9 PE=1 SV=1 5 458 2.0E-18
sp|Q6P3K3|FBX9_DANRE F-box only protein 9 OS=Danio rerio GN=fbxo9 PE=2 SV=1 3 390 3.0E-17
sp|Q9XI00|SKI32_ARATH F-box protein 7 OS=Arabidopsis thaliana GN=SKIP32 PE=1 SV=1 151 364 2.0E-11
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4657
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5563 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|365
Ophiocordyceps camponoti-floridani Ophcf2|01019
Ophiocordyceps camponoti-rufipedis Ophun1|2310
Ophiocordyceps kimflemingae Ophio5|5113
Ophiocordyceps subramaniannii Hirsu2|9823

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5563
MPTKLDSELDSFRQQWLLDLQAHNATTPSSPPPKAKPPPSPWPGSAGPHDRDGAAPPEPVSGKQTPPRNLVSALD
HFEEAMAMEAQGNMGDSLKLYRMAYKLDSRVDGCYRDKHLAPVAPTAETHSPPQCAPLQSTPPLPPTDDLIASFG
GLTIQPAPPQVQGDPLPPCPLASLPTELLSLIFAHVAASDPGDVMAATRTCKRLTYLILCQAPSVWKAAALSPRF
GFPAMMRRFLCAIDPTAHSSPQDAELIAAQAHAESRLALSLIPSTYPSWMHMFRSRPRIRFNGCYISTVNYIRSG
QASTNQATWDTSPVHIVTYYRYLRFFPDGSALSLLSTTPPADIVHHLSRQTVHSHRASPATSYLPSAPVRAALYG
RWRLGHAPDESNLYVETEGVGPKYLYRMHLALRSSPSAAAHNGALNTKLSWRAFYSYNKLTDDWAEFGLKNDRSF
VFSRVRSYGMGY*
Coding >OphauG2|5563
ATGCCCACCAAACTCGACTCGGAACTCGACTCGTTTCGCCAACAATGGCTCTTGGACCTACAAGCCCACAATGCC
ACGACTCCGTCATCACCGCCACCCAAGGCCAAGCCGCCCCCATCCCCCTGGCCAGGAAGCGCCGGCCCCCATGAC
CGAGACGGCGCTGCCCCTCCAGAGCCGGTTTCTGGCAAGCAGACGCCACCACGCAACCTCGTGTCTGCCCTGGAC
CACTTTGAAGAAGCCATGGCCATGGAGGCCCAAGGCAACATGGGCGATAGCTTGAAGCTGTATCGCATGGCGTAC
AAGCTTGATAGCCGTGTTGATGGCTGCTATCGTGACAAACACCTCGCTCCTGTTGCGCCCACTGCCGAGACTCAC
TCTCCCCCCCAATGCGCACCGCTCCAATCCACGCCTCCTCTACCTCCTACAGACGACCTCATCGCCTCCTTTGGC
GGCCTCACCATCCAGCCCGCGCCACCACAGGTCCAAGGCGACCCTCTGCCGCCCTGCCCCCTCGCGTCCCTGCCC
ACCGAGCTTCTCTCCCTCATCTTCGCACACGTTGCCGCCTCGGACCCCGGAGACGTCATGGCGGCCACTCGCACC
TGCAAGCGCCTCACCTATCTCATTCTCTGCCAGGCCCCTTCCGTCTGGAAAGCCGCCGCTCTCTCTCCGCGCTTT
GGCTTCCCCGCCATGATGCGCCGCTTCCTCTGCGCCATTGATCCGACGGCCCATTCGAGTCCCCAAGACGCGGAG
CTCATCGCTGCCCAAGCCCATGCCGAATCACGTCTCGCCCTCTCCCTCATCCCCTCCACCTACCCTTCGTGGATG
CACATGTTTCGCTCGCGTCCGCGCATCCGCTTCAACGGCTGCTACATCAGCACCGTAAACTACATTCGCTCCGGC
CAGGCCTCCACCAACCAGGCCACCTGGGACACCAGCCCCGTCCACATCGTCACCTACTACCGCTACTTGCGCTTC
TTCCCCGACGGCTCGGCCCTCAGTCTGCTGTCCACAACGCCCCCCGCCGACATTGTGCACCACCTGTCTCGCCAA
ACTGTCCACTCCCACCGCGCCTCTCCCGCTACTTCGTACCTCCCCTCTGCGCCTGTCCGCGCCGCTCTCTACGGC
AGATGGCGACTGGGACACGCCCCAGACGAATCAAATCTCTATGTCGAGACTGAAGGTGTCGGCCCAAAGTACCTG
TATCGCATGCACCTTGCCTTGCGTAGCTCTCCCTCGGCCGCCGCCCATAACGGCGCTCTCAACACCAAGCTCTCA
TGGCGCGCCTTTTACAGCTACAACAAGCTGACCGATGACTGGGCAGAGTTTGGTCTCAAAAACGACCGCTCCTTT
GTTTTTAGCCGTGTCCGCAGCTACGGCATGGGCTACTAG
Transcript >OphauG2|5563
ATGCCCACCAAACTCGACTCGGAACTCGACTCGTTTCGCCAACAATGGCTCTTGGACCTACAAGCCCACAATGCC
ACGACTCCGTCATCACCGCCACCCAAGGCCAAGCCGCCCCCATCCCCCTGGCCAGGAAGCGCCGGCCCCCATGAC
CGAGACGGCGCTGCCCCTCCAGAGCCGGTTTCTGGCAAGCAGACGCCACCACGCAACCTCGTGTCTGCCCTGGAC
CACTTTGAAGAAGCCATGGCCATGGAGGCCCAAGGCAACATGGGCGATAGCTTGAAGCTGTATCGCATGGCGTAC
AAGCTTGATAGCCGTGTTGATGGCTGCTATCGTGACAAACACCTCGCTCCTGTTGCGCCCACTGCCGAGACTCAC
TCTCCCCCCCAATGCGCACCGCTCCAATCCACGCCTCCTCTACCTCCTACAGACGACCTCATCGCCTCCTTTGGC
GGCCTCACCATCCAGCCCGCGCCACCACAGGTCCAAGGCGACCCTCTGCCGCCCTGCCCCCTCGCGTCCCTGCCC
ACCGAGCTTCTCTCCCTCATCTTCGCACACGTTGCCGCCTCGGACCCCGGAGACGTCATGGCGGCCACTCGCACC
TGCAAGCGCCTCACCTATCTCATTCTCTGCCAGGCCCCTTCCGTCTGGAAAGCCGCCGCTCTCTCTCCGCGCTTT
GGCTTCCCCGCCATGATGCGCCGCTTCCTCTGCGCCATTGATCCGACGGCCCATTCGAGTCCCCAAGACGCGGAG
CTCATCGCTGCCCAAGCCCATGCCGAATCACGTCTCGCCCTCTCCCTCATCCCCTCCACCTACCCTTCGTGGATG
CACATGTTTCGCTCGCGTCCGCGCATCCGCTTCAACGGCTGCTACATCAGCACCGTAAACTACATTCGCTCCGGC
CAGGCCTCCACCAACCAGGCCACCTGGGACACCAGCCCCGTCCACATCGTCACCTACTACCGCTACTTGCGCTTC
TTCCCCGACGGCTCGGCCCTCAGTCTGCTGTCCACAACGCCCCCCGCCGACATTGTGCACCACCTGTCTCGCCAA
ACTGTCCACTCCCACCGCGCCTCTCCCGCTACTTCGTACCTCCCCTCTGCGCCTGTCCGCGCCGCTCTCTACGGC
AGATGGCGACTGGGACACGCCCCAGACGAATCAAATCTCTATGTCGAGACTGAAGGTGTCGGCCCAAAGTACCTG
TATCGCATGCACCTTGCCTTGCGTAGCTCTCCCTCGGCCGCCGCCCATAACGGCGCTCTCAACACCAAGCTCTCA
TGGCGCGCCTTTTACAGCTACAACAAGCTGACCGATGACTGGGCAGAGTTTGGTCTCAAAAACGACCGCTCCTTT
GTTTTTAGCCGTGTCCGCAGCTACGGCATGGGCTACTAG
Gene >OphauG2|5563
ATGCCCACCAAACTCGACTCGGAACTCGACTCGTTTCGCCAACAATGGCTCTTGGACCTACAAGCCCACAATGCC
ACGACTCCGTCATCACCGCCACCCAAGGCCAAGCCGCCCCCATCCCCCTGGCCAGGAAGCGCCGGCCCCCATGAC
CGAGACGGCGCTGCCCCTCCAGAGCCGGTTTCTGGCAAGCAGACGCCACCACGCAACCTCGTGTCTGCCCTGGAC
CACTTTGAAGAAGCCATGGCCATGGAGGCCCAAGGCAACATGGGCGATAGCTTGAAGCTGTATCGCATGGCGTAC
AAGGTGCGCCTCGGCCTTTGCCCAGCCTGCTGCTTAATGGCCATGTGCTAAAGTCGAGCAGCTTGATAGCCGTGT
TGATGGCTGCTATCGTGACAAACACCTCGCTCCTGTTGCGCCCACTGCCGAGACTCACTCTCCCCCCCAATGCGC
ACCGCTCCAATCCACGCCTCCTCTACCTCCTACAGACGACCTCATCGCCTCCTTTGGCGGCCTCACCATCCAGCC
CGCGCCACCACAGGTCCAAGGCGACCCTCTGCCGCCCTGCCCCCTCGCGTCCCTGCCCACCGAGCTTCTCTCCCT
CATCTTCGCACACGTTGCCGCCTCGGACCCCGGAGACGTCATGGCGGCCACTCGCACCTGCAAGCGCCTCACCTA
TCTCATTCTCTGCCAGGCCCCTTCCGTCTGGAAAGCCGCCGCTCTCTCTCCGCGCTTTGGCTTCCCCGCCATGAT
GCGCCGCTTCCTCTGCGCCATTGATCCGACGGCCCATTCGAGTCCCCAAGACGCGGAGCTCATCGCTGCCCAAGC
CCATGCCGAATCACGTCTCGCCCTCTCCCTCATCCCCTCCACCTACCCTTCGTGGATGCACATGTTTCGCTCGCG
TCCGCGCATCCGCTTCAACGGCTGCTACATCAGCACCGTAAACTACATTCGCTCCGGCCAGGCCTCCACCAACCA
GGCCACCTGGGACACCAGCCCCGTCCACATCGTCACCTACTACCGCTACTTGCGCTTCTTCCCCGACGGCTCGGC
CCTCAGTCTGCTGTCCACAACGCCCCCCGCCGACATTGTGCACCACCTGTCTCGCCAAACTGTCCACTCCCACCG
CGCCTCTCCCGCTACTTCGTACCTCCCCTCTGCGCCTGTCCGCGCCGCTCTCTACGGCAGATGGCGACTGGGACA
CGCCCCAGACGAATCAAATCTCTATGTCGAGACTGAAGGTGTCGGCCCAAAGTACCTGTATCGCATGCACCTTGC
CTTGCGTAGCTCTCCCTCGGCCGCCGCCCATAACGGCGCTCTCAACACCAAGCTCTCATGGCGCGCCTTTTACAG
CTACAACAAGCTGACCGATGACTGGGCAGAGTTTGGTCTCAAAAACGACCGCTCCTTTGTTTTTAGCCGTGTCCG
CAGCTACGGCATGGGCTACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail