Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5559
Gene name
LocationContig_517:6779..8388
Strand-
Gene length (bp)1609
Transcript length (bp)1545
Coding sequence length (bp)1545
Protein length (aa) 515

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04981 NMD3 NMD3 family 6.2E-76 25 255

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38861|NMD3_YEAST 60S ribosomal export protein NMD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NMD3 PE=1 SV=3 17 513 0.0E+00
sp|Q09817|NMD3_SCHPO 60S ribosomal export protein nmd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nmd3 PE=3 SV=1 3 511 4.0E-178
sp|Q55BF2|NMD3_DICDI 60S ribosomal export protein NMD3 OS=Dictyostelium discoideum GN=nmd3 PE=3 SV=1 17 505 2.0E-158
sp|Q99L48|NMD3_MOUSE 60S ribosomal export protein NMD3 OS=Mus musculus GN=Nmd3 PE=1 SV=1 12 507 3.0E-147
sp|Q96D46|NMD3_HUMAN 60S ribosomal export protein NMD3 OS=Homo sapiens GN=NMD3 PE=1 SV=1 12 507 7.0E-147
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38861|NMD3_YEAST 60S ribosomal export protein NMD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NMD3 PE=1 SV=3 17 513 0.0E+00
sp|Q09817|NMD3_SCHPO 60S ribosomal export protein nmd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nmd3 PE=3 SV=1 3 511 4.0E-178
sp|Q55BF2|NMD3_DICDI 60S ribosomal export protein NMD3 OS=Dictyostelium discoideum GN=nmd3 PE=3 SV=1 17 505 2.0E-158
sp|Q99L48|NMD3_MOUSE 60S ribosomal export protein NMD3 OS=Mus musculus GN=Nmd3 PE=1 SV=1 12 507 3.0E-147
sp|Q96D46|NMD3_HUMAN 60S ribosomal export protein NMD3 OS=Homo sapiens GN=NMD3 PE=1 SV=1 12 507 7.0E-147
sp|Q5RC82|NMD3_PONAB 60S ribosomal export protein NMD3 OS=Pongo abelii GN=NMD3 PE=2 SV=1 15 507 1.0E-145
sp|Q08DS5|NMD3_BOVIN 60S ribosomal export protein NMD3 OS=Bos taurus GN=NMD3 PE=2 SV=1 12 507 2.0E-143
sp|Q6P2Z6|NMD3_XENTR 60S ribosomal export protein NMD3 OS=Xenopus tropicalis GN=nmd3 PE=2 SV=1 16 507 4.0E-138
sp|Q6GNS3|NMD3_XENLA 60S ribosomal export protein NMD3 OS=Xenopus laevis GN=nmd3 PE=2 SV=1 16 507 4.0E-128
sp|Q5BLF0|NMD3_DANRE 60S ribosomal export protein NMD3 OS=Danio rerio GN=nmd3 PE=2 SV=1 19 506 6.0E-121
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4329
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5559 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2718
Ophiocordyceps camponoti-floridani Ophcf2|04097
Ophiocordyceps camponoti-rufipedis Ophun1|1748
Ophiocordyceps kimflemingae Ophio5|3988
Ophiocordyceps subramaniannii Hirsu2|8893

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5559
MSMDIDEAPVAIGNAAQQTGATILCCNCGAPIDGTKATGALCFACVKLTVDISQGIQREATVNFCRDCDRWLMPP
NSWVVAMPESRELLALCLKKLRGLNRARIVDASFVWTEPHSRRIKVKITIQEAVQDGILLQQSFEVVYLVATQQC
PECAKSYTANVWRACVQVRQKVLHKRTFLFLEQLIMKHGAHRDTLNIKEAKDGIDFFFSQRNQAEKFLDFLNSVA
PVKVKSSQELISQDIHTSKKSFKFTFSAELVPICRDDLVALPIKIAKQCGNISPLVLCHKIGTSVYFMDPQTLQT
TDISAHIYWRAPFSSLADARELVEFIIMDIEQTATRRGKWVLSEATVARASDLGANDKTYFTRTHLGHYLQPGDS
AMGYMLTGTMFNNADFEAMEESSTYSSTIPDVVLVKKHYPGRRRNRRRHWKLKRMDKDEGELLPKKAEQERMDNE
YEQFLRDVEEDEELRAALALYKSEKQGDAMSIADTEDDDQDGAVPQIDMEELLDDFEDMAIEEQ*
Coding >OphauG2|5559
ATGTCCATGGATATAGACGAGGCCCCTGTGGCCATTGGCAATGCCGCACAGCAAACAGGCGCAACAATTCTGTGC
TGCAACTGCGGTGCTCCCATCGACGGCACAAAGGCAACCGGTGCCCTATGCTTTGCATGTGTCAAACTCACAGTC
GATATCTCGCAAGGCATCCAGCGCGAAGCGACAGTCAACTTTTGCCGCGACTGCGATCGATGGCTGATGCCCCCA
AATAGCTGGGTGGTGGCCATGCCCGAGTCTCGCGAGCTGCTTGCCCTGTGTCTCAAGAAACTGAGGGGCCTTAAT
AGGGCCCGTATTGTCGATGCTAGCTTTGTCTGGACAGAGCCCCACTCGCGACGAATAAAGGTCAAAATCACTATT
CAAGAAGCCGTTCAAGACGGTATTCTGCTACAGCAAAGTTTTGAAGTGGTCTACCTGGTTGCCACACAGCAATGT
CCCGAGTGCGCAAAGTCTTACACAGCAAATGTATGGCGCGCCTGCGTCCAGGTTCGGCAAAAAGTTTTGCACAAG
CGAACCTTTCTCTTCCTTGAACAGCTCATTATGAAGCACGGCGCCCACAGAGATACCCTTAATATTAAAGAAGCC
AAGGACGGTATCGACTTTTTCTTTTCTCAACGCAACCAAGCGGAAAAATTTCTCGACTTTCTCAACTCTGTTGCA
CCCGTCAAGGTCAAGTCATCACAGGAACTGATATCTCAGGACATACACACGTCAAAAAAGTCGTTCAAGTTTACT
TTTTCCGCCGAGCTGGTGCCTATATGTAGAGATGACTTGGTTGCCTTGCCTATAAAGATTGCCAAGCAATGCGGA
AACATTTCTCCACTGGTTCTCTGCCATAAGATTGGCACTTCAGTCTACTTCATGGACCCCCAAACATTACAGACG
ACGGATATTAGCGCTCATATATACTGGCGAGCTCCCTTCTCATCCCTGGCAGATGCCCGTGAGCTCGTGGAATTT
ATAATCATGGACATCGAGCAGACGGCGACACGGAGGGGCAAGTGGGTGCTCTCCGAGGCGACGGTGGCGCGTGCA
TCAGACCTCGGCGCCAATGACAAAACGTACTTTACAAGAACACACCTCGGTCACTACCTACAACCGGGCGACTCG
GCAATGGGGTACATGCTGACGGGCACCATGTTCAACAATGCCGATTTTGAGGCCATGGAAGAGTCTAGCACATAT
TCGTCGACAATACCAGACGTTGTGCTCGTTAAGAAACACTACCCTGGACGGCGGCGGAACAGACGTCGCCACTGG
AAACTTAAGCGCATGGATAAGGACGAGGGCGAGCTACTGCCCAAGAAGGCGGAGCAGGAGCGCATGGATAATGAG
TACGAGCAGTTCTTGCGCGACGTTGAAGAGGATGAAGAGCTCAGGGCGGCACTGGCGCTGTATAAGAGTGAGAAG
CAGGGAGACGCCATGAGCATAGCGGACACGGAGGACGACGACCAAGACGGCGCTGTGCCGCAAATAGATATGGAG
GAGCTGCTAGATGACTTTGAGGACATGGCTATAGAGGAGCAATAG
Transcript >OphauG2|5559
ATGTCCATGGATATAGACGAGGCCCCTGTGGCCATTGGCAATGCCGCACAGCAAACAGGCGCAACAATTCTGTGC
TGCAACTGCGGTGCTCCCATCGACGGCACAAAGGCAACCGGTGCCCTATGCTTTGCATGTGTCAAACTCACAGTC
GATATCTCGCAAGGCATCCAGCGCGAAGCGACAGTCAACTTTTGCCGCGACTGCGATCGATGGCTGATGCCCCCA
AATAGCTGGGTGGTGGCCATGCCCGAGTCTCGCGAGCTGCTTGCCCTGTGTCTCAAGAAACTGAGGGGCCTTAAT
AGGGCCCGTATTGTCGATGCTAGCTTTGTCTGGACAGAGCCCCACTCGCGACGAATAAAGGTCAAAATCACTATT
CAAGAAGCCGTTCAAGACGGTATTCTGCTACAGCAAAGTTTTGAAGTGGTCTACCTGGTTGCCACACAGCAATGT
CCCGAGTGCGCAAAGTCTTACACAGCAAATGTATGGCGCGCCTGCGTCCAGGTTCGGCAAAAAGTTTTGCACAAG
CGAACCTTTCTCTTCCTTGAACAGCTCATTATGAAGCACGGCGCCCACAGAGATACCCTTAATATTAAAGAAGCC
AAGGACGGTATCGACTTTTTCTTTTCTCAACGCAACCAAGCGGAAAAATTTCTCGACTTTCTCAACTCTGTTGCA
CCCGTCAAGGTCAAGTCATCACAGGAACTGATATCTCAGGACATACACACGTCAAAAAAGTCGTTCAAGTTTACT
TTTTCCGCCGAGCTGGTGCCTATATGTAGAGATGACTTGGTTGCCTTGCCTATAAAGATTGCCAAGCAATGCGGA
AACATTTCTCCACTGGTTCTCTGCCATAAGATTGGCACTTCAGTCTACTTCATGGACCCCCAAACATTACAGACG
ACGGATATTAGCGCTCATATATACTGGCGAGCTCCCTTCTCATCCCTGGCAGATGCCCGTGAGCTCGTGGAATTT
ATAATCATGGACATCGAGCAGACGGCGACACGGAGGGGCAAGTGGGTGCTCTCCGAGGCGACGGTGGCGCGTGCA
TCAGACCTCGGCGCCAATGACAAAACGTACTTTACAAGAACACACCTCGGTCACTACCTACAACCGGGCGACTCG
GCAATGGGGTACATGCTGACGGGCACCATGTTCAACAATGCCGATTTTGAGGCCATGGAAGAGTCTAGCACATAT
TCGTCGACAATACCAGACGTTGTGCTCGTTAAGAAACACTACCCTGGACGGCGGCGGAACAGACGTCGCCACTGG
AAACTTAAGCGCATGGATAAGGACGAGGGCGAGCTACTGCCCAAGAAGGCGGAGCAGGAGCGCATGGATAATGAG
TACGAGCAGTTCTTGCGCGACGTTGAAGAGGATGAAGAGCTCAGGGCGGCACTGGCGCTGTATAAGAGTGAGAAG
CAGGGAGACGCCATGAGCATAGCGGACACGGAGGACGACGACCAAGACGGCGCTGTGCCGCAAATAGATATGGAG
GAGCTGCTAGATGACTTTGAGGACATGGCTATAGAGGAGCAATAG
Gene >OphauG2|5559
ATGTCCATGGATATAGACGAGGCCCCTGTGGCCATTGGCAATGCCGCACAGCAAACAGGCGCAACGTGAGTTCCC
AAGTCATTATGCCAATAATCGAAATTGTAGATTATTGATGTTGGGCATGCTTAGAATTCTGTGCTGCAACTGCGG
TGCTCCCATCGACGGCACAAAGGCAACCGGTGCCCTATGCTTTGCATGTGTCAAACTCACAGTCGATATCTCGCA
AGGCATCCAGCGCGAAGCGACAGTCAACTTTTGCCGCGACTGCGATCGATGGCTGATGCCCCCAAATAGCTGGGT
GGTGGCCATGCCCGAGTCTCGCGAGCTGCTTGCCCTGTGTCTCAAGAAACTGAGGGGCCTTAATAGGGCCCGTAT
TGTCGATGCTAGCTTTGTCTGGACAGAGCCCCACTCGCGACGAATAAAGGTCAAAATCACTATTCAAGAAGCCGT
TCAAGACGGTATTCTGCTACAGCAAAGTTTTGAAGTGGTCTACCTGGTTGCCACACAGCAATGTCCCGAGTGCGC
AAAGTCTTACACAGCAAATGTATGGCGCGCCTGCGTCCAGGTTCGGCAAAAAGTTTTGCACAAGCGAACCTTTCT
CTTCCTTGAACAGCTCATTATGAAGCACGGCGCCCACAGAGATACCCTTAATATTAAAGAAGCCAAGGACGGTAT
CGACTTTTTCTTTTCTCAACGCAACCAAGCGGAAAAATTTCTCGACTTTCTCAACTCTGTTGCACCCGTCAAGGT
CAAGTCATCACAGGAACTGATATCTCAGGACATACACACGTCAAAAAAGTCGTTCAAGTTTACTTTTTCCGCCGA
GCTGGTGCCTATATGTAGAGATGACTTGGTTGCCTTGCCTATAAAGATTGCCAAGCAATGCGGAAACATTTCTCC
ACTGGTTCTCTGCCATAAGATTGGCACTTCAGTCTACTTCATGGACCCCCAAACATTACAGACGACGGATATTAG
CGCTCATATATACTGGCGAGCTCCCTTCTCATCCCTGGCAGATGCCCGTGAGCTCGTGGAATTTATAATCATGGA
CATCGAGCAGACGGCGACACGGAGGGGCAAGTGGGTGCTCTCCGAGGCGACGGTGGCGCGTGCATCAGACCTCGG
CGCCAATGACAAAACGTACTTTACAAGAACACACCTCGGTCACTACCTACAACCGGGCGACTCGGCAATGGGGTA
CATGCTGACGGGCACCATGTTCAACAATGCCGATTTTGAGGCCATGGAAGAGTCTAGCACATATTCGTCGACAAT
ACCAGACGTTGTGCTCGTTAAGAAACACTACCCTGGACGGCGGCGGAACAGACGTCGCCACTGGAAACTTAAGCG
CATGGATAAGGACGAGGGCGAGCTACTGCCCAAGAAGGCGGAGCAGGAGCGCATGGATAATGAGTACGAGCAGTT
CTTGCGCGACGTTGAAGAGGATGAAGAGCTCAGGGCGGCACTGGCGCTGTATAAGAGTGAGAAGCAGGGAGACGC
CATGAGCATAGCGGACACGGAGGACGACGACCAAGACGGCGCTGTGCCGCAAATAGATATGGAGGAGCTGCTAGA
TGACTTTGAGGACATGGCTATAGAGGAGCAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail