Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5551
Gene name
LocationContig_516:307..1483
Strand-
Gene length (bp)1176
Transcript length (bp)1176
Coding sequence length (bp)1176
Protein length (aa) 392

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12808 Mto2_bdg Micro-tubular organiser Mto1 C-term Mto2-binding region 4.6E-10 339 385

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O60039|APSB_EMENI Anucleate primary sterigmata protein B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=apsB PE=4 SV=2 1 385 2.0E-70

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup11703
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5551 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5551
MQRELENAIHDLDTSKASLVEKDRIIKQRDALLESHALESRKVAEMLEKERLAHRNTKAQFETFQKTHHHMSQTA
STQDVRIAELESTRGHDRKRLATLEQSMREQLQQRNELLLKLWQKLSGLCGREWANSNTLVDRLAVPSVEVIANR
LPGFSKNLFAAVKTVEAMFASLQTRIKSVERDLERDYQTLEHNVELRTKKLDRLETMVRNVVASTPHETLARMQR
LEEAYRQLKVENTTLKSAQDVRSRAAKLYRDGTVQSLSGSPSPSVPRGPGDRDLGQRSSRSSGAGSGSGGGDGSG
GGAMRPRSTCDAAALVGSSSMDVALTSDGASAPTNNDNRWLFRLRDMEYKLKMEREGRNQDRQAARQRLGGLEVE
NRQLRERVRRTTSEAD*
Coding >OphauG2|5551
ATGCAGCGCGAACTGGAAAATGCCATTCACGACCTCGACACTTCCAAGGCATCGCTAGTTGAAAAGGATCGCATC
ATCAAGCAACGCGACGCCTTGCTCGAGTCGCACGCGCTCGAGAGCCGCAAAGTGGCCGAGATGCTGGAAAAGGAG
CGCCTGGCCCACCGCAACACAAAGGCCCAGTTTGAGACTTTTCAAAAGACGCACCACCACATGTCGCAGACTGCA
AGCACCCAAGACGTGCGAATCGCCGAGCTGGAAAGCACCCGAGGCCACGACCGCAAAAGACTGGCCACGCTGGAG
CAAAGCATGCGCGAGCAGCTCCAGCAACGCAACGAGCTCCTCCTCAAGCTCTGGCAAAAGCTGAGCGGGCTGTGC
GGCCGCGAATGGGCCAATAGTAACACGCTTGTCGATAGGCTGGCTGTGCCGTCGGTGGAAGTAATTGCCAATCGG
CTGCCCGGCTTCTCCAAGAATCTCTTTGCCGCGGTCAAGACGGTCGAGGCCATGTTTGCCAGTCTGCAGACGCGA
ATCAAGTCTGTGGAGCGCGACTTGGAGCGAGACTACCAGACGCTTGAACACAATGTCGAGTTGCGCACCAAGAAA
CTCGATCGTCTCGAAACCATGGTTCGCAACGTCGTGGCATCGACTCCCCACGAAACACTGGCTCGCATGCAGCGC
CTCGAAGAGGCATATCGCCAGCTCAAGGTTGAAAACACGACGCTCAAATCCGCCCAAGACGTGCGCAGCCGAGCC
GCCAAGCTTTACCGCGACGGCACCGTGCAAAGCCTTTCCGGCTCCCCATCGCCGTCTGTGCCGCGCGGGCCCGGC
GACCGGGACCTTGGCCAGCGCAGCAGTAGGTCCAGCGGCGCTGGCAGTGGCAGTGGCGGCGGTGACGGGAGTGGT
GGTGGCGCAATGCGCCCGCGCTCGACATGTGATGCCGCAGCGCTGGTTGGTAGCAGCAGCATGGACGTGGCGCTG
ACTAGCGATGGCGCCTCGGCCCCAACTAACAATGACAACCGGTGGCTGTTTCGCCTGCGCGACATGGAGTACAAG
CTGAAGATGGAGCGAGAAGGGCGGAACCAGGATCGCCAGGCGGCGAGGCAGAGGCTCGGGGGGCTCGAGGTTGAG
AATCGCCAACTGAGGGAGCGGGTGCGCCGGACTACTTCAGAGGCTGACTGA
Transcript >OphauG2|5551
ATGCAGCGCGAACTGGAAAATGCCATTCACGACCTCGACACTTCCAAGGCATCGCTAGTTGAAAAGGATCGCATC
ATCAAGCAACGCGACGCCTTGCTCGAGTCGCACGCGCTCGAGAGCCGCAAAGTGGCCGAGATGCTGGAAAAGGAG
CGCCTGGCCCACCGCAACACAAAGGCCCAGTTTGAGACTTTTCAAAAGACGCACCACCACATGTCGCAGACTGCA
AGCACCCAAGACGTGCGAATCGCCGAGCTGGAAAGCACCCGAGGCCACGACCGCAAAAGACTGGCCACGCTGGAG
CAAAGCATGCGCGAGCAGCTCCAGCAACGCAACGAGCTCCTCCTCAAGCTCTGGCAAAAGCTGAGCGGGCTGTGC
GGCCGCGAATGGGCCAATAGTAACACGCTTGTCGATAGGCTGGCTGTGCCGTCGGTGGAAGTAATTGCCAATCGG
CTGCCCGGCTTCTCCAAGAATCTCTTTGCCGCGGTCAAGACGGTCGAGGCCATGTTTGCCAGTCTGCAGACGCGA
ATCAAGTCTGTGGAGCGCGACTTGGAGCGAGACTACCAGACGCTTGAACACAATGTCGAGTTGCGCACCAAGAAA
CTCGATCGTCTCGAAACCATGGTTCGCAACGTCGTGGCATCGACTCCCCACGAAACACTGGCTCGCATGCAGCGC
CTCGAAGAGGCATATCGCCAGCTCAAGGTTGAAAACACGACGCTCAAATCCGCCCAAGACGTGCGCAGCCGAGCC
GCCAAGCTTTACCGCGACGGCACCGTGCAAAGCCTTTCCGGCTCCCCATCGCCGTCTGTGCCGCGCGGGCCCGGC
GACCGGGACCTTGGCCAGCGCAGCAGTAGGTCCAGCGGCGCTGGCAGTGGCAGTGGCGGCGGTGACGGGAGTGGT
GGTGGCGCAATGCGCCCGCGCTCGACATGTGATGCCGCAGCGCTGGTTGGTAGCAGCAGCATGGACGTGGCGCTG
ACTAGCGATGGCGCCTCGGCCCCAACTAACAATGACAACCGGTGGCTGTTTCGCCTGCGCGACATGGAGTACAAG
CTGAAGATGGAGCGAGAAGGGCGGAACCAGGATCGCCAGGCGGCGAGGCAGAGGCTCGGGGGGCTCGAGGTTGAG
AATCGCCAACTGAGGGAGCGGGTGCGCCGGACTACTTCAGAGGCTGACTGA
Gene >OphauG2|5551
ATGCAGCGCGAACTGGAAAATGCCATTCACGACCTCGACACTTCCAAGGCATCGCTAGTTGAAAAGGATCGCATC
ATCAAGCAACGCGACGCCTTGCTCGAGTCGCACGCGCTCGAGAGCCGCAAAGTGGCCGAGATGCTGGAAAAGGAG
CGCCTGGCCCACCGCAACACAAAGGCCCAGTTTGAGACTTTTCAAAAGACGCACCACCACATGTCGCAGACTGCA
AGCACCCAAGACGTGCGAATCGCCGAGCTGGAAAGCACCCGAGGCCACGACCGCAAAAGACTGGCCACGCTGGAG
CAAAGCATGCGCGAGCAGCTCCAGCAACGCAACGAGCTCCTCCTCAAGCTCTGGCAAAAGCTGAGCGGGCTGTGC
GGCCGCGAATGGGCCAATAGTAACACGCTTGTCGATAGGCTGGCTGTGCCGTCGGTGGAAGTAATTGCCAATCGG
CTGCCCGGCTTCTCCAAGAATCTCTTTGCCGCGGTCAAGACGGTCGAGGCCATGTTTGCCAGTCTGCAGACGCGA
ATCAAGTCTGTGGAGCGCGACTTGGAGCGAGACTACCAGACGCTTGAACACAATGTCGAGTTGCGCACCAAGAAA
CTCGATCGTCTCGAAACCATGGTTCGCAACGTCGTGGCATCGACTCCCCACGAAACACTGGCTCGCATGCAGCGC
CTCGAAGAGGCATATCGCCAGCTCAAGGTTGAAAACACGACGCTCAAATCCGCCCAAGACGTGCGCAGCCGAGCC
GCCAAGCTTTACCGCGACGGCACCGTGCAAAGCCTTTCCGGCTCCCCATCGCCGTCTGTGCCGCGCGGGCCCGGC
GACCGGGACCTTGGCCAGCGCAGCAGTAGGTCCAGCGGCGCTGGCAGTGGCAGTGGCGGCGGTGACGGGAGTGGT
GGTGGCGCAATGCGCCCGCGCTCGACATGTGATGCCGCAGCGCTGGTTGGTAGCAGCAGCATGGACGTGGCGCTG
ACTAGCGATGGCGCCTCGGCCCCAACTAACAATGACAACCGGTGGCTGTTTCGCCTGCGCGACATGGAGTACAAG
CTGAAGATGGAGCGAGAAGGGCGGAACCAGGATCGCCAGGCGGCGAGGCAGAGGCTCGGGGGGCTCGAGGTTGAG
AATCGCCAACTGAGGGAGCGGGTGCGCCGGACTACTTCAGAGGCTGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail