Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5541
Gene name
LocationContig_513:4913..6599
Strand+
Gene length (bp)1686
Transcript length (bp)1686
Coding sequence length (bp)1686
Protein length (aa) 562

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13402 Peptidase_M60 Peptidase M60, enhancin and enhancin-like 1.7E-54 266 530
PF17291 M60-like_N N-terminal domain of M60-like peptidases 1.7E-08 152 259

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6QR59|TCAF3_MOUSE TRPM8 channel-associated factor 3 OS=Mus musculus GN=Tcaf3 PE=1 SV=1 238 546 3.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5541
MRFAVFAVGIPLVVGVPWDVVSGKQRAVKEVKRWIFAPGNANGMNFVWSTDDLKPKAGSAGQDSVKGKPVVEAPP
AAPPAAAPAAPPQNPQPVARPTPALLAKPIEEAPPVSGPKPVVEGPPAVPGDGERLGQGQESKFAHPRTIKVAAL
PNNEDERQRLNQNLVWADFHPTGFYVGARQVLKVKVSGVRDNGPQPEILVGTPNLIDPARPFQDMRAMLVPSGPL
GNGDHDVENDVDGIIYIRYVYGRDQEAPPPVSVTLEGDAAQPIPLFRQGVTTDEEWVDMLRETKVPFAEHVGERV
ILTGLKRDALVYAERGQKQEELLNRYKAIIAAQDAISGLRADAADARDRPSPLRPMVVQTNRMVYANAWSWRAAI
GQSTISDIWWQPELERSWKIWHELGHHRQHSPTWSWEAVAEVTVNIYTLAARRLVPEIPSSETEHGTVEEWNKAK
RYLEQGRQFKDFDRADLIVMLVMFEQLREVFGDGFYHELHRRSRAEPVQYEGEADKKHHFMALAANVTGHDLTPF
FETWGLRPEGRTVEEMARQPQKMGWDFSQQPVFGGE*
Coding >OphauG2|5541
ATGCGTTTTGCAGTGTTTGCAGTTGGGATTCCGCTGGTGGTGGGAGTTCCGTGGGATGTGGTGAGTGGGAAGCAG
AGGGCTGTGAAGGAGGTCAAGAGGTGGATTTTTGCGCCGGGCAACGCAAATGGGATGAATTTTGTGTGGTCGACG
GATGATTTGAAGCCAAAGGCTGGCAGTGCTGGGCAGGATTCGGTCAAGGGGAAGCCGGTGGTGGAGGCTCCTCCG
GCGGCTCCTCCGGCGGCTGCCCCGGCGGCGCCTCCACAGAATCCGCAGCCGGTGGCGAGGCCTACTCCGGCGTTG
CTCGCCAAGCCGATTGAGGAAGCCCCTCCCGTGTCGGGTCCCAAGCCAGTGGTGGAAGGGCCCCCTGCAGTGCCT
GGGGATGGAGAGCGCCTCGGGCAGGGCCAAGAGTCAAAGTTTGCGCATCCACGAACAATAAAGGTCGCGGCCCTG
CCCAACAATGAGGATGAGAGACAGCGACTGAATCAGAACCTTGTGTGGGCCGACTTCCACCCCACAGGCTTCTAC
GTTGGGGCTCGTCAGGTGCTCAAGGTCAAGGTGTCGGGGGTCAGGGACAATGGGCCGCAGCCAGAGATTTTGGTG
GGCACGCCCAACTTGATTGACCCTGCGAGGCCGTTTCAGGACATGAGGGCCATGTTGGTGCCTTCAGGGCCGCTT
GGCAACGGGGACCACGATGTTGAGAACGACGTGGACGGCATCATTTACATTCGCTATGTTTACGGACGGGACCAA
GAGGCGCCACCGCCTGTCAGTGTGACGCTGGAGGGAGACGCGGCGCAGCCGATACCGCTATTCCGACAGGGCGTA
ACGACTGACGAGGAGTGGGTGGACATGCTACGCGAGACAAAGGTTCCGTTTGCTGAACACGTGGGCGAGCGAGTG
ATTCTCACGGGACTCAAGCGCGATGCGCTCGTGTATGCCGAGAGAGGGCAGAAGCAGGAGGAGCTCCTCAACAGG
TACAAGGCGATTATAGCAGCCCAAGACGCGATTAGCGGACTGCGGGCCGACGCAGCAGATGCTCGAGATCGACCC
AGTCCTCTGCGGCCCATGGTGGTGCAGACAAACAGGATGGTGTATGCCAACGCATGGTCATGGCGAGCGGCCATT
GGACAAAGCACCATCAGCGACATTTGGTGGCAGCCGGAACTGGAGCGGTCGTGGAAGATTTGGCACGAGCTGGGC
CACCACCGGCAGCACAGCCCAACATGGAGCTGGGAGGCAGTGGCCGAGGTGACGGTGAATATATACACGCTGGCA
GCGCGGCGGCTGGTGCCTGAGATTCCGAGCAGCGAGACGGAGCACGGGACGGTGGAGGAGTGGAACAAGGCAAAG
CGCTATCTGGAGCAGGGGCGACAGTTTAAAGACTTTGACCGGGCAGACTTGATTGTGATGCTCGTCATGTTTGAG
CAGCTGCGCGAGGTGTTTGGCGATGGGTTTTATCATGAGCTGCATCGTAGGTCGAGGGCGGAGCCGGTGCAGTAT
GAGGGGGAGGCGGATAAGAAGCATCATTTCATGGCGCTGGCGGCCAATGTCACGGGGCACGACTTGACGCCGTTT
TTCGAGACGTGGGGGCTGCGGCCAGAGGGGCGGACGGTTGAGGAGATGGCGAGGCAGCCGCAGAAGATGGGCTGG
GACTTTAGCCAGCAGCCGGTTTTTGGAGGCGAGTAG
Transcript >OphauG2|5541
ATGCGTTTTGCAGTGTTTGCAGTTGGGATTCCGCTGGTGGTGGGAGTTCCGTGGGATGTGGTGAGTGGGAAGCAG
AGGGCTGTGAAGGAGGTCAAGAGGTGGATTTTTGCGCCGGGCAACGCAAATGGGATGAATTTTGTGTGGTCGACG
GATGATTTGAAGCCAAAGGCTGGCAGTGCTGGGCAGGATTCGGTCAAGGGGAAGCCGGTGGTGGAGGCTCCTCCG
GCGGCTCCTCCGGCGGCTGCCCCGGCGGCGCCTCCACAGAATCCGCAGCCGGTGGCGAGGCCTACTCCGGCGTTG
CTCGCCAAGCCGATTGAGGAAGCCCCTCCCGTGTCGGGTCCCAAGCCAGTGGTGGAAGGGCCCCCTGCAGTGCCT
GGGGATGGAGAGCGCCTCGGGCAGGGCCAAGAGTCAAAGTTTGCGCATCCACGAACAATAAAGGTCGCGGCCCTG
CCCAACAATGAGGATGAGAGACAGCGACTGAATCAGAACCTTGTGTGGGCCGACTTCCACCCCACAGGCTTCTAC
GTTGGGGCTCGTCAGGTGCTCAAGGTCAAGGTGTCGGGGGTCAGGGACAATGGGCCGCAGCCAGAGATTTTGGTG
GGCACGCCCAACTTGATTGACCCTGCGAGGCCGTTTCAGGACATGAGGGCCATGTTGGTGCCTTCAGGGCCGCTT
GGCAACGGGGACCACGATGTTGAGAACGACGTGGACGGCATCATTTACATTCGCTATGTTTACGGACGGGACCAA
GAGGCGCCACCGCCTGTCAGTGTGACGCTGGAGGGAGACGCGGCGCAGCCGATACCGCTATTCCGACAGGGCGTA
ACGACTGACGAGGAGTGGGTGGACATGCTACGCGAGACAAAGGTTCCGTTTGCTGAACACGTGGGCGAGCGAGTG
ATTCTCACGGGACTCAAGCGCGATGCGCTCGTGTATGCCGAGAGAGGGCAGAAGCAGGAGGAGCTCCTCAACAGG
TACAAGGCGATTATAGCAGCCCAAGACGCGATTAGCGGACTGCGGGCCGACGCAGCAGATGCTCGAGATCGACCC
AGTCCTCTGCGGCCCATGGTGGTGCAGACAAACAGGATGGTGTATGCCAACGCATGGTCATGGCGAGCGGCCATT
GGACAAAGCACCATCAGCGACATTTGGTGGCAGCCGGAACTGGAGCGGTCGTGGAAGATTTGGCACGAGCTGGGC
CACCACCGGCAGCACAGCCCAACATGGAGCTGGGAGGCAGTGGCCGAGGTGACGGTGAATATATACACGCTGGCA
GCGCGGCGGCTGGTGCCTGAGATTCCGAGCAGCGAGACGGAGCACGGGACGGTGGAGGAGTGGAACAAGGCAAAG
CGCTATCTGGAGCAGGGGCGACAGTTTAAAGACTTTGACCGGGCAGACTTGATTGTGATGCTCGTCATGTTTGAG
CAGCTGCGCGAGGTGTTTGGCGATGGGTTTTATCATGAGCTGCATCGTAGGTCGAGGGCGGAGCCGGTGCAGTAT
GAGGGGGAGGCGGATAAGAAGCATCATTTCATGGCGCTGGCGGCCAATGTCACGGGGCACGACTTGACGCCGTTT
TTCGAGACGTGGGGGCTGCGGCCAGAGGGGCGGACGGTTGAGGAGATGGCGAGGCAGCCGCAGAAGATGGGCTGG
GACTTTAGCCAGCAGCCGGTTTTTGGAGGCGAGTAG
Gene >OphauG2|5541
ATGCGTTTTGCAGTGTTTGCAGTTGGGATTCCGCTGGTGGTGGGAGTTCCGTGGGATGTGGTGAGTGGGAAGCAG
AGGGCTGTGAAGGAGGTCAAGAGGTGGATTTTTGCGCCGGGCAACGCAAATGGGATGAATTTTGTGTGGTCGACG
GATGATTTGAAGCCAAAGGCTGGCAGTGCTGGGCAGGATTCGGTCAAGGGGAAGCCGGTGGTGGAGGCTCCTCCG
GCGGCTCCTCCGGCGGCTGCCCCGGCGGCGCCTCCACAGAATCCGCAGCCGGTGGCGAGGCCTACTCCGGCGTTG
CTCGCCAAGCCGATTGAGGAAGCCCCTCCCGTGTCGGGTCCCAAGCCAGTGGTGGAAGGGCCCCCTGCAGTGCCT
GGGGATGGAGAGCGCCTCGGGCAGGGCCAAGAGTCAAAGTTTGCGCATCCACGAACAATAAAGGTCGCGGCCCTG
CCCAACAATGAGGATGAGAGACAGCGACTGAATCAGAACCTTGTGTGGGCCGACTTCCACCCCACAGGCTTCTAC
GTTGGGGCTCGTCAGGTGCTCAAGGTCAAGGTGTCGGGGGTCAGGGACAATGGGCCGCAGCCAGAGATTTTGGTG
GGCACGCCCAACTTGATTGACCCTGCGAGGCCGTTTCAGGACATGAGGGCCATGTTGGTGCCTTCAGGGCCGCTT
GGCAACGGGGACCACGATGTTGAGAACGACGTGGACGGCATCATTTACATTCGCTATGTTTACGGACGGGACCAA
GAGGCGCCACCGCCTGTCAGTGTGACGCTGGAGGGAGACGCGGCGCAGCCGATACCGCTATTCCGACAGGGCGTA
ACGACTGACGAGGAGTGGGTGGACATGCTACGCGAGACAAAGGTTCCGTTTGCTGAACACGTGGGCGAGCGAGTG
ATTCTCACGGGACTCAAGCGCGATGCGCTCGTGTATGCCGAGAGAGGGCAGAAGCAGGAGGAGCTCCTCAACAGG
TACAAGGCGATTATAGCAGCCCAAGACGCGATTAGCGGACTGCGGGCCGACGCAGCAGATGCTCGAGATCGACCC
AGTCCTCTGCGGCCCATGGTGGTGCAGACAAACAGGATGGTGTATGCCAACGCATGGTCATGGCGAGCGGCCATT
GGACAAAGCACCATCAGCGACATTTGGTGGCAGCCGGAACTGGAGCGGTCGTGGAAGATTTGGCACGAGCTGGGC
CACCACCGGCAGCACAGCCCAACATGGAGCTGGGAGGCAGTGGCCGAGGTGACGGTGAATATATACACGCTGGCA
GCGCGGCGGCTGGTGCCTGAGATTCCGAGCAGCGAGACGGAGCACGGGACGGTGGAGGAGTGGAACAAGGCAAAG
CGCTATCTGGAGCAGGGGCGACAGTTTAAAGACTTTGACCGGGCAGACTTGATTGTGATGCTCGTCATGTTTGAG
CAGCTGCGCGAGGTGTTTGGCGATGGGTTTTATCATGAGCTGCATCGTAGGTCGAGGGCGGAGCCGGTGCAGTAT
GAGGGGGAGGCGGATAAGAAGCATCATTTCATGGCGCTGGCGGCCAATGTCACGGGGCACGACTTGACGCCGTTT
TTCGAGACGTGGGGGCTGCGGCCAGAGGGGCGGACGGTTGAGGAGATGGCGAGGCAGCCGCAGAAGATGGGCTGG
GACTTTAGCCAGCAGCCGGTTTTTGGAGGCGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail