Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5540
Gene name
LocationContig_513:1108..3293
Strand+
Gene length (bp)2185
Transcript length (bp)2052
Coding sequence length (bp)2052
Protein length (aa) 684

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 270 469 3.0E-10
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 315 473 1.0E-09
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 268 407 2.0E-09
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 347 492 1.0E-06
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 268 409 2.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2064
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5540 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3771
Ophiocordyceps camponoti-floridani Ophcf2|04765
Ophiocordyceps camponoti-rufipedis Ophun1|26
Ophiocordyceps kimflemingae Ophio5|5744
Ophiocordyceps subramaniannii Hirsu2|2380

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5540
MSLKQRPSKQTSLPGESSRSNTYHRHSSEEDRHSHSSYTEEDDDEAEYLDDSLYQDNIYTDSEGGEVQPSESAST
RPSLSQPLSSSRAAPHRQPLAHQHQDHYHSVRDPAPISSSVAHSDDFGGGYYAPATFHPPFQRGSGLYNNNRSHG
LAQYHQYSQNQGGHYMTGYPGGNQMVPYGAYNGHNPFTPLNNGSSGASYFSGAEPRHPYEMMPYQPPPGYYGPPP
HYNLPAHMQQFTLSPPAQQQPTTEAPAQKTPSPAPKEPPIDLEKIRSEAQEAAKKEHEEKIKAINDQQEREARIR
KEAEESFLRRMDEIRQQQEEAQKEIARAKAEAEKAALAKIEADRKAREEREKLEAEALKRAEENAIRKYEKEQKE
AEQLRVKEQEMRERIEADAKRRLEEALRHEAETKAAAAQKASEEAERIKLMHEEAQRKAEADARAKLEAEAEAKR
KVAEAEEAAKQEHEALKKKIQDEARAAALEAAEEAARAKGEKGAIRFKDAVGRKFNFPYNICNTWQGMQALIKQA
FLHVEVIGPHVQEGRYDLTGPDGEIILPLVWEKVVQPDWAIEMTMWPVEEKKPEPPMPDMPPNGMRPGGMPMPHG
PGGPGMGRPPRGMAVPGMMPGWGPPTGHSPPHLPDDLGMPGMPGIPGMMPRNVKKQHRTNTKKIPAGVFDYIIGS
KPSKHRKK*
Coding >OphauG2|5540
ATGTCACTCAAGCAACGCCCCTCTAAACAAACTTCTTTACCGGGCGAGTCGTCCAGATCAAACACGTACCACAGG
CACTCTAGTGAAGAAGACAGACACTCTCACAGCTCGTATACCGAAGAAGACGACGACGAGGCTGAATATCTAGAC
GATTCACTTTATCAAGACAATATCTACACCGACTCGGAAGGCGGCGAAGTCCAGCCGAGTGAGTCTGCGTCTACG
AGGCCTTCTCTCTCCCAACCCCTTTCCTCATCCAGGGCCGCTCCTCATCGCCAGCCGCTGGCGCACCAACACCAA
GACCACTATCATTCGGTGCGGGACCCCGCACCAATCTCGTCCAGCGTGGCTCACTCGGACGATTTCGGCGGTGGC
TACTACGCCCCCGCCACCTTTCACCCACCCTTCCAGCGCGGCTCCGGCCTCTACAACAACAACCGCTCTCATGGC
CTTGCTCAATATCACCAGTATTCCCAGAATCAAGGCGGCCACTACATGACGGGCTATCCCGGCGGCAATCAAATG
GTGCCTTATGGCGCCTACAACGGCCACAACCCTTTTACTCCTCTCAACAATGGCTCCAGTGGCGCCAGTTACTTT
AGTGGTGCTGAGCCCAGACACCCATATGAAATGATGCCCTATCAGCCTCCCCCAGGCTATTACGGCCCGCCTCCT
CACTATAATCTCCCTGCTCATATGCAACAGTTTACCCTGTCGCCTCCGGCACAGCAGCAACCGACTACTGAGGCA
CCGGCACAAAAGACACCATCTCCGGCGCCCAAGGAGCCCCCAATTGATCTCGAAAAAATCAGGTCTGAAGCTCAA
GAGGCAGCCAAGAAGGAACACGAGGAGAAGATCAAGGCAATCAACGACCAACAGGAGCGCGAAGCCCGAATTCGC
AAGGAGGCTGAGGAATCTTTCTTGCGCAGGATGGACGAAATTCGACAGCAACAGGAAGAGGCCCAAAAAGAGATT
GCGCGGGCAAAGGCCGAGGCCGAGAAAGCAGCCTTGGCTAAAATCGAGGCTGACCGCAAAGCTCGGGAAGAGAGG
GAGAAGCTCGAGGCCGAGGCGCTGAAGCGAGCAGAGGAAAACGCTATTCGCAAGTACGAAAAGGAACAAAAGGAA
GCCGAGCAACTCCGGGTGAAGGAGCAGGAGATGCGCGAGCGCATAGAAGCAGATGCCAAAAGGCGTCTTGAAGAA
GCACTTCGACATGAAGCCGAAACCAAGGCTGCTGCTGCCCAGAAGGCGAGCGAGGAGGCTGAACGCATCAAGCTG
ATGCACGAGGAGGCGCAGCGCAAGGCCGAAGCTGATGCCAGGGCTAAACTCGAGGCCGAAGCAGAGGCCAAGAGA
AAAGTCGCCGAGGCTGAAGAGGCGGCCAAGCAGGAGCACGAGGCCCTCAAGAAGAAGATTCAAGACGAGGCGCGA
GCCGCTGCCCTCGAGGCTGCCGAGGAAGCTGCCCGGGCCAAGGGCGAAAAGGGCGCCATCAGGTTCAAGGATGCG
GTGGGACGAAAGTTTAACTTTCCCTACAATATTTGCAACACATGGCAGGGCATGCAAGCTCTCATCAAACAGGCC
TTTCTGCATGTCGAAGTGATTGGACCCCACGTTCAAGAGGGCCGATACGATTTGACGGGTCCAGATGGCGAAATT
ATCTTGCCCTTGGTCTGGGAAAAGGTGGTGCAGCCGGACTGGGCAATTGAGATGACCATGTGGCCAGTAGAAGAG
AAGAAGCCGGAGCCACCCATGCCCGACATGCCGCCGAATGGTATGAGGCCTGGAGGCATGCCCATGCCACACGGT
CCAGGAGGCCCAGGAATGGGACGGCCTCCAAGGGGCATGGCTGTTCCGGGCATGATGCCGGGATGGGGGCCACCC
ACTGGACACTCACCTCCGCATCTGCCCGATGACTTGGGCATGCCTGGCATGCCTGGAATTCCGGGCATGATGCCA
CGCAACGTCAAGAAGCAGCACCGCACCAACACCAAGAAGATACCCGCGGGTGTCTTTGACTACATAATAGGGTCC
AAACCTAGTAAGCATAGGAAAAAGTAG
Transcript >OphauG2|5540
ATGTCACTCAAGCAACGCCCCTCTAAACAAACTTCTTTACCGGGCGAGTCGTCCAGATCAAACACGTACCACAGG
CACTCTAGTGAAGAAGACAGACACTCTCACAGCTCGTATACCGAAGAAGACGACGACGAGGCTGAATATCTAGAC
GATTCACTTTATCAAGACAATATCTACACCGACTCGGAAGGCGGCGAAGTCCAGCCGAGTGAGTCTGCGTCTACG
AGGCCTTCTCTCTCCCAACCCCTTTCCTCATCCAGGGCCGCTCCTCATCGCCAGCCGCTGGCGCACCAACACCAA
GACCACTATCATTCGGTGCGGGACCCCGCACCAATCTCGTCCAGCGTGGCTCACTCGGACGATTTCGGCGGTGGC
TACTACGCCCCCGCCACCTTTCACCCACCCTTCCAGCGCGGCTCCGGCCTCTACAACAACAACCGCTCTCATGGC
CTTGCTCAATATCACCAGTATTCCCAGAATCAAGGCGGCCACTACATGACGGGCTATCCCGGCGGCAATCAAATG
GTGCCTTATGGCGCCTACAACGGCCACAACCCTTTTACTCCTCTCAACAATGGCTCCAGTGGCGCCAGTTACTTT
AGTGGTGCTGAGCCCAGACACCCATATGAAATGATGCCCTATCAGCCTCCCCCAGGCTATTACGGCCCGCCTCCT
CACTATAATCTCCCTGCTCATATGCAACAGTTTACCCTGTCGCCTCCGGCACAGCAGCAACCGACTACTGAGGCA
CCGGCACAAAAGACACCATCTCCGGCGCCCAAGGAGCCCCCAATTGATCTCGAAAAAATCAGGTCTGAAGCTCAA
GAGGCAGCCAAGAAGGAACACGAGGAGAAGATCAAGGCAATCAACGACCAACAGGAGCGCGAAGCCCGAATTCGC
AAGGAGGCTGAGGAATCTTTCTTGCGCAGGATGGACGAAATTCGACAGCAACAGGAAGAGGCCCAAAAAGAGATT
GCGCGGGCAAAGGCCGAGGCCGAGAAAGCAGCCTTGGCTAAAATCGAGGCTGACCGCAAAGCTCGGGAAGAGAGG
GAGAAGCTCGAGGCCGAGGCGCTGAAGCGAGCAGAGGAAAACGCTATTCGCAAGTACGAAAAGGAACAAAAGGAA
GCCGAGCAACTCCGGGTGAAGGAGCAGGAGATGCGCGAGCGCATAGAAGCAGATGCCAAAAGGCGTCTTGAAGAA
GCACTTCGACATGAAGCCGAAACCAAGGCTGCTGCTGCCCAGAAGGCGAGCGAGGAGGCTGAACGCATCAAGCTG
ATGCACGAGGAGGCGCAGCGCAAGGCCGAAGCTGATGCCAGGGCTAAACTCGAGGCCGAAGCAGAGGCCAAGAGA
AAAGTCGCCGAGGCTGAAGAGGCGGCCAAGCAGGAGCACGAGGCCCTCAAGAAGAAGATTCAAGACGAGGCGCGA
GCCGCTGCCCTCGAGGCTGCCGAGGAAGCTGCCCGGGCCAAGGGCGAAAAGGGCGCCATCAGGTTCAAGGATGCG
GTGGGACGAAAGTTTAACTTTCCCTACAATATTTGCAACACATGGCAGGGCATGCAAGCTCTCATCAAACAGGCC
TTTCTGCATGTCGAAGTGATTGGACCCCACGTTCAAGAGGGCCGATACGATTTGACGGGTCCAGATGGCGAAATT
ATCTTGCCCTTGGTCTGGGAAAAGGTGGTGCAGCCGGACTGGGCAATTGAGATGACCATGTGGCCAGTAGAAGAG
AAGAAGCCGGAGCCACCCATGCCCGACATGCCGCCGAATGGTATGAGGCCTGGAGGCATGCCCATGCCACACGGT
CCAGGAGGCCCAGGAATGGGACGGCCTCCAAGGGGCATGGCTGTTCCGGGCATGATGCCGGGATGGGGGCCACCC
ACTGGACACTCACCTCCGCATCTGCCCGATGACTTGGGCATGCCTGGCATGCCTGGAATTCCGGGCATGATGCCA
CGCAACGTCAAGAAGCAGCACCGCACCAACACCAAGAAGATACCCGCGGGTGTCTTTGACTACATAATAGGGTCC
AAACCTAGTAAGCATAGGAAAAAGTAG
Gene >OphauG2|5540
ATGTCGTAAGTCGTTGCCGCCTGTGCGACTTTTGCCCTCTTCAAAAGGGCTCCGTTCGCTTACACGGAGCTAGAC
TCAAGCAACGCCCCTCTAAACAAACTTCTTTACCGGGCGAGTCGTCCAGATCAAACACGTACCACAGGCACTCTA
GTGAAGAAGACAGACACTCTCACAGCTCGTATACCGAAGAAGACGACGACGAGGCTGAATATCTAGACGATTCAC
TTTATCAAGACAATATCTACACCGACTCGGAAGGCGGCGAAGTCCAGCCGAGTGAGTCTGCGTCTACGAGGCCTT
CTCTCTCCCAACCCCTTTCCTCATCCAGGGCCGCTCCTCATCGCCAGCCGCTGGCGCACCAACACCAAGACCACT
ATCATTCGGTGCGGGACCCCGCACCAATCTCGTCCAGCGTGGCTCACTCGGACGATTTCGGCGGTGGCTACTACG
CCCCCGCCACCTTTCACCCACCCTTCCAGCGCGGCTCCGGCCTCTACAACAACAACCGCTCTCATGGCCTTGCTC
AATATCACCAGTATTCCCAGAATCAAGGCGGCCACTACATGACGGGCTATCCCGGCGGCAATCAAATGGTGCCTT
ATGGCGCCTACAACGGCCACAACCCTTTTACTCCTCTCAACAATGGCTCCAGTGGCGCCAGTTACTTTAGTGGTG
CTGAGCCCAGACACCCATATGAAATGATGCCCTATCAGCCTCCCCCAGGCTATTACGGCCCGCCTCCTCACTATA
ATCTCCCTGCTCATATGCAACAGTTTACCCTGTCGCCTCCGGCACAGCAGCAACCGACTACTGAGGCACCGGCAC
AAAAGACACCATCTCCGGCGCCCAAGGAGCCCCCAATTGATCTCGAAAAAATCAGGTCTGAAGCTCAAGAGGCAG
CCAAGAAGGAACACGAGGAGAAGATCAAGGCAATCAACGACCAACAGGAGCGCGAAGCCCGAATTCGCAAGGAGG
CTGAGGAATCTTTCTTGCGCAGGATGGACGAAATTCGACAGCAACAGGAAGAGGCCCAAAAAGAGATTGCGCGGG
CAAAGGCCGAGGCCGAGAAAGCAGCCTTGGCTAAAATCGAGGCTGACCGCAAAGCTCGGGAAGAGAGGGAGAAGC
TCGAGGCCGAGGCGCTGAAGCGAGCAGAGGAAAACGCTATTCGCAAGTACGAAAAGGAACAAAAGGAAGCCGAGC
AACTCCGGGTGAAGGAGCAGGAGATGCGCGAGCGCATAGAAGCAGATGCCAAAAGGCGTCTTGAAGAAGCACTTC
GACATGAAGCCGAAACCAAGGCTGCTGCTGCCCAGAAGGCGAGCGAGGAGGCTGAACGCATCAAGCTGATGCACG
AGGAGGCGCAGCGCAAGGCCGAAGCTGATGCCAGGGCTAAACTCGAGGCCGAAGCAGAGGCCAAGAGAAAAGTCG
CCGAGGCTGAAGAGGCGGCCAAGCAGGAGCACGAGGCCCTCAAGAAGAAGATTCAAGACGAGGCGCGAGCCGCTG
CCCTCGAGGCTGCCGAGGAAGCTGCCCGGGCCAAGGGCGAAAAGGGCGCCATCAGGTTCAAGGATGCGGTGGGAC
GAAAGTTTAACTTTCCCTACAATATTTGCAACACATGGCAGGTATGTCAACAAGAAGGGCCTTCTTTACAGCACC
GTCATGTGCATACTGACTCGTTTGTCTGCAGGGCATGCAAGCTCTCATCAAACAGGCCTTTCTGCATGTCGAAGT
GATTGGACCCCACGTTCAAGAGGGCCGATACGATTTGACGGGTCCAGATGGCGAAATTATCTTGCCCTTGGTCTG
GGAAAAGGTGGTGCAGCCGGACTGGGCAATTGAGATGACCATGTGGCCAGTAGAAGAGAAGAAGCCGGAGCCACC
CATGCCCGACATGCCGCCGAATGGTATGAGGCCTGGAGGCATGCCCATGCCACACGGTCCAGGAGGCCCAGGAAT
GGGACGGCCTCCAAGGGGCATGGCTGTTCCGGGCATGATGCCGGGATGGGGGCCACCCACTGGACACTCACCTCC
GCATCTGCCCGATGACTTGGGCATGCCTGGCATGCCTGGAATTCCGGGCATGATGCCACGCAACGTCAAGAAGCA
GCACCGCACCAACACCAAGAAGATACCCGCGGGTGTCTTTGACTACATAATAGGGTCCAAACCTAGTAAGCATAG
GAAAAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail