Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5538
Gene name
LocationContig_512:4638..5736
Strand-
Gene length (bp)1098
Transcript length (bp)1035
Coding sequence length (bp)1035
Protein length (aa) 345

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10294 Methyltransf_16 Lysine methyltransferase 1.3E-17 110 285

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40389|RRG1_SCHPO Protein-lysine N-methyltransferase rrg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrg1 PE=2 SV=1 6 319 5.0E-33
sp|P38347|EFM2_YEAST Protein-lysine N-methyltransferase EFM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFM2 PE=1 SV=1 52 319 2.0E-29
sp|A7IQW5|MT21_CAEEL Protein-lysine methyltransferase C42C1.13 OS=Caenorhabditis elegans GN=C42C1.13 PE=3 SV=1 156 289 8.0E-07
sp|Q96AZ1|MT21B_HUMAN Protein-lysine methyltransferase METTL21B OS=Homo sapiens GN=METTL21B PE=1 SV=1 163 268 2.0E-06
sp|A4FV98|MT21B_BOVIN Protein-lysine methyltransferase METTL21B OS=Bos taurus GN=METTL21B PE=2 SV=1 163 261 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5538
MASTLDWPQVWQKPSYQQLAKTLNGLELNPPVWRHGRRRSDVAVPETAQPDKEQVTRYLSSIIKSPLEWIDDSEQ
QEHIWEVASRRIAERCGRTAMGEVVRRWPLGREQEIQLVIREPALTGDLLGFKTWASSYVLAQHLPRLASASLFR
LFDESFGRPAPTVLELGSGTGLLGLAAAAQWKVPVVLSDLPAIVRNLEHNVESNRALVEERGGSLAVGALTWGAS
GSDHVDEALFGKPFQFKIVLAADGLYDDNHPTLLASAVGQHLAIDSEARAIIMVPERDAATTRLREALKQAMLDL
DSPIFCQDEDELVGQDDWGEDDEAGRVRCWLGVFSRGGTPASLC*
Coding >OphauG2|5538
ATGGCGTCAACGCTAGACTGGCCGCAAGTATGGCAAAAGCCAAGCTACCAACAACTGGCCAAGACACTCAACGGA
CTAGAACTCAACCCTCCTGTTTGGAGACATGGACGGCGTCGATCCGACGTGGCAGTTCCAGAGACGGCCCAGCCA
GACAAGGAGCAAGTAACGCGCTACTTGTCGTCCATCATCAAGAGCCCCTTGGAGTGGATCGACGACTCTGAGCAG
CAGGAACACATCTGGGAGGTGGCGAGTCGCCGGATAGCTGAGCGATGCGGAAGAACGGCCATGGGTGAGGTGGTG
CGGCGGTGGCCACTGGGTCGCGAGCAGGAAATCCAACTCGTGATTCGAGAGCCAGCTCTGACGGGAGATTTGCTG
GGCTTCAAGACGTGGGCATCGTCGTATGTGCTGGCACAGCATCTGCCGCGATTAGCATCGGCATCACTCTTCAGG
CTCTTTGACGAATCGTTTGGGCGGCCGGCGCCAACAGTCTTGGAACTTGGGTCCGGTACCGGATTGTTGGGACTT
GCAGCGGCGGCGCAGTGGAAGGTGCCAGTAGTGTTGAGCGACTTGCCAGCCATTGTGCGCAATCTCGAGCACAAT
GTGGAGAGCAACAGGGCCTTGGTGGAGGAGCGTGGCGGATCACTGGCTGTTGGGGCGCTGACGTGGGGCGCAAGC
GGCAGCGATCATGTTGACGAGGCGCTCTTTGGCAAGCCCTTCCAATTCAAGATTGTGCTAGCAGCAGATGGCCTA
TACGACGACAATCATCCGACGCTGCTAGCCTCTGCCGTGGGACAGCACCTAGCCATTGATTCCGAGGCACGGGCA
ATAATCATGGTGCCTGAGCGCGACGCGGCGACGACACGGCTGCGCGAGGCGTTGAAGCAGGCCATGCTGGATCTC
GACAGTCCAATCTTTTGCCAAGACGAGGACGAATTGGTGGGACAAGACGACTGGGGCGAGGACGATGAGGCAGGC
CGGGTGCGGTGCTGGCTTGGCGTCTTTTCGCGAGGGGGGACGCCAGCGAGTTTGTGTTGA
Transcript >OphauG2|5538
ATGGCGTCAACGCTAGACTGGCCGCAAGTATGGCAAAAGCCAAGCTACCAACAACTGGCCAAGACACTCAACGGA
CTAGAACTCAACCCTCCTGTTTGGAGACATGGACGGCGTCGATCCGACGTGGCAGTTCCAGAGACGGCCCAGCCA
GACAAGGAGCAAGTAACGCGCTACTTGTCGTCCATCATCAAGAGCCCCTTGGAGTGGATCGACGACTCTGAGCAG
CAGGAACACATCTGGGAGGTGGCGAGTCGCCGGATAGCTGAGCGATGCGGAAGAACGGCCATGGGTGAGGTGGTG
CGGCGGTGGCCACTGGGTCGCGAGCAGGAAATCCAACTCGTGATTCGAGAGCCAGCTCTGACGGGAGATTTGCTG
GGCTTCAAGACGTGGGCATCGTCGTATGTGCTGGCACAGCATCTGCCGCGATTAGCATCGGCATCACTCTTCAGG
CTCTTTGACGAATCGTTTGGGCGGCCGGCGCCAACAGTCTTGGAACTTGGGTCCGGTACCGGATTGTTGGGACTT
GCAGCGGCGGCGCAGTGGAAGGTGCCAGTAGTGTTGAGCGACTTGCCAGCCATTGTGCGCAATCTCGAGCACAAT
GTGGAGAGCAACAGGGCCTTGGTGGAGGAGCGTGGCGGATCACTGGCTGTTGGGGCGCTGACGTGGGGCGCAAGC
GGCAGCGATCATGTTGACGAGGCGCTCTTTGGCAAGCCCTTCCAATTCAAGATTGTGCTAGCAGCAGATGGCCTA
TACGACGACAATCATCCGACGCTGCTAGCCTCTGCCGTGGGACAGCACCTAGCCATTGATTCCGAGGCACGGGCA
ATAATCATGGTGCCTGAGCGCGACGCGGCGACGACACGGCTGCGCGAGGCGTTGAAGCAGGCCATGCTGGATCTC
GACAGTCCAATCTTTTGCCAAGACGAGGACGAATTGGTGGGACAAGACGACTGGGGCGAGGACGATGAGGCAGGC
CGGGTGCGGTGCTGGCTTGGCGTCTTTTCGCGAGGGGGGACGCCAGCGAGTTTGTGTTGA
Gene >OphauG2|5538
ATGGCGTCAACGCTAGACTGGCCGCAAGTATGGCAAAAGCCAAGCTACCAACAACTGGCCAAGACACTCAACGGA
CTAGAACTCAACCCTCCTGTTTGGAGACATGGACGGCGTCGATCCGACGTGGCAGTTCCAGAGACGGCCCAGCCA
GACAAGGAGCAAGTAACGCGCTACTTGTCGTCCATCATCAAGAGCCCCTTGGAGTGGATCGACGACTCTGAGCAG
CAGGAACACATCTGGGAGGTGGCGAGTCGCCGGATAGCTGAGCGATGCGGAAGAACGGCCATGGGTGAGGTGGTG
CGGCGGTGGCCACTGGGTCGCGAGCAGGAAATCCAACTCGTGATTCGAGAGCCAGCTCTGACGGGAGATTTGCTG
GGCTTCAAGACGTGGGCATCGTCGTATGTGCTGGCACAGCATCTGCCGCGATTAGCATCGGCATCACTCTTCAGG
CTCTTTGACGAATCGTTTGGGCGGCCGGCGCCAACAGTCTTGGAACTTGGGTCCGGTACCGGATTGTTGGGACTT
GCAGCGGCGGCGCAGTGGAAGGTGCCAGTAGTGTTGAGCGACTTGCCAGCCATTGTGCGCAATCTCGAGCACAAT
GTGGAGAGCAACAGGGCCTTGGTGGAGGAGCGTGGCGGATCACTGGCTGTTGGGGCGCTGACGTGGGGCGCAAGC
GGCAGCGATCATGTTGACGAGGCGCTCTTTGGCAAGCCCTTCCAATTCAAGGTGAGGGGGGACGGATGGCCTAGC
TGCCGACAGAGAATTGAGCTGACACGTCTTTGTTTCTAGATTGTGCTAGCAGCAGATGGCCTATACGACGACAAT
CATCCGACGCTGCTAGCCTCTGCCGTGGGACAGCACCTAGCCATTGATTCCGAGGCACGGGCAATAATCATGGTG
CCTGAGCGCGACGCGGCGACGACACGGCTGCGCGAGGCGTTGAAGCAGGCCATGCTGGATCTCGACAGTCCAATC
TTTTGCCAAGACGAGGACGAATTGGTGGGACAAGACGACTGGGGCGAGGACGATGAGGCAGGCCGGGTGCGGTGC
TGGCTTGGCGTCTTTTCGCGAGGGGGGACGCCAGCGAGTTTGTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail