Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5531
Gene name
LocationContig_511:2139..3829
Strand-
Gene length (bp)1690
Transcript length (bp)1614
Coding sequence length (bp)1614
Protein length (aa) 538

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00649 Copper-fist Copper fist DNA binding domain 2.0E-18 3 40

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q92258|GRISA_PODAS Protein GRISEA OS=Podospora anserina GN=grisea PE=3 SV=1 1 139 4.0E-33
sp|Q09728|CUF1_SCHPO Metal-binding regulatory protein cuf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cuf1 PE=1 SV=1 1 71 7.0E-09
sp|P15315|CUP2_YEAST Transcriptional activator protein CUP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CUP2 PE=1 SV=1 1 46 6.0E-07
sp|Q12753|HAA1_YEAST Transcriptional activator HAA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAA1 PE=1 SV=1 1 46 2.0E-06
sp|P45815|CRF1_YARLI Copper resistance protein CRF1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CRF1 PE=3 SV=1 1 72 3.0E-06

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0003700 DNA-binding transcription factor activity Yes
GO:0005507 copper ion binding Yes
GO:0003676 nucleic acid binding No
GO:0060255 regulation of macromolecule metabolic process No
GO:0010468 regulation of gene expression No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0050789 regulation of biological process No
GO:1901363 heterocyclic compound binding No
GO:0046872 metal ion binding No
GO:0031323 regulation of cellular metabolic process No
GO:0043167 ion binding No
GO:0019222 regulation of metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050794 regulation of cellular process No
GO:0080090 regulation of primary metabolic process No
GO:0008150 biological_process No
GO:0140110 transcription regulator activity No
GO:0009889 regulation of biosynthetic process No
GO:0065007 biological regulation No
GO:0005488 binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0043169 cation binding No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4910
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5531 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7093
Ophiocordyceps camponoti-floridani Ophcf2|01207
Ophiocordyceps camponoti-rufipedis Ophun1|6977
Ophiocordyceps kimflemingae Ophio5|5593
Ophiocordyceps subramaniannii Hirsu2|1453

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5531
MPLINGQKMACEPCIRGHRSTKCTHANERLMVPVRKPGRPLSSCPHPSSRACSCAAVTAAIPRKQKCRCGSAPTA
AAENASHDKEPDMAPSSPSKAAAASGFRVQKAASKSAPSRKQSVDPNGLERMNSNQLNILTQYNSAPRAPSFSDG
PCPSAPDMSIYGAMQLTPAECSFGSESTLFSPVFQFPLQPSSAGVGPIKPGANGGFSRGAVGSMASRVTPVVESC
CTGSTSRVQAQTSAQLVQPPSPADNGSRADKPKGGCCSTTDKAKGAKSQTGSLPAAPSLGQQASSGAILSYQASM
TVPNAVYPYYSQPTIYNYPPQFGSFLQPLQPEQWRQFMATINYGQSVAAAPGYGMNAPGSPSAHSSAVHSASGIS
WTSHQCSCGDSCQCVGCAAHPYNDATQDYVRSAWNTMMQDGQKLSNGTHTTAHLNGHGADGSAKDGNGRTTARTA
NDGTTHPDGTVSPPAPQTPSDGTSGINEEQTLSANDFFFVSYPFGDTCAGETASCPCGDDCQCIGCVIHHNPGPE
QTDGNGSDNQHA*
Coding >OphauG2|5531
ATGCCTCTGATCAATGGCCAGAAGATGGCTTGCGAGCCGTGTATTCGTGGCCATCGATCCACCAAATGCACTCAT
GCCAACGAACGCCTCATGGTACCCGTTCGAAAGCCCGGCCGCCCGTTGAGCTCGTGTCCACACCCTTCGTCGCGC
GCCTGCTCTTGCGCCGCCGTGACTGCAGCGATCCCGAGGAAACAAAAGTGTCGCTGCGGCAGTGCGCCCACGGCA
GCGGCCGAGAACGCCTCTCATGACAAGGAGCCGGACATGGCGCCGTCGAGCCCGTCCAAAGCTGCAGCAGCATCT
GGCTTCCGTGTCCAAAAGGCCGCGTCCAAGAGCGCGCCAAGCAGAAAACAGTCTGTTGATCCTAATGGGCTGGAA
AGAATGAACTCGAACCAGCTCAACATCTTGACGCAGTATAACAGCGCGCCCCGCGCCCCCTCGTTTTCCGACGGG
CCTTGTCCTTCGGCACCCGACATGTCTATTTACGGAGCCATGCAACTCACTCCGGCCGAATGCTCCTTTGGCTCC
GAGTCGACTCTGTTTTCTCCCGTCTTCCAGTTCCCGCTGCAGCCGTCCTCGGCGGGCGTTGGGCCAATCAAGCCT
GGGGCAAATGGCGGCTTCAGTCGCGGCGCAGTCGGCTCCATGGCCTCGAGGGTGACGCCCGTCGTGGAGAGCTGC
TGCACTGGCAGCACCAGCAGAGTGCAGGCCCAGACAAGTGCTCAGCTGGTGCAACCCCCATCGCCGGCTGACAAC
GGCTCTCGCGCAGACAAGCCCAAGGGGGGCTGCTGTTCCACTACAGACAAGGCAAAAGGCGCCAAGTCGCAGACG
GGCTCTCTACCCGCCGCCCCCAGTCTCGGTCAACAGGCGTCGAGCGGTGCCATCCTGTCATACCAGGCTTCCATG
ACGGTGCCCAATGCCGTGTACCCCTATTACTCGCAGCCCACCATCTACAACTACCCTCCGCAGTTTGGATCATTC
CTTCAACCCCTTCAGCCAGAACAGTGGAGACAATTCATGGCAACCATCAACTACGGCCAGTCTGTTGCCGCCGCG
CCTGGCTATGGCATGAATGCGCCGGGCTCTCCGTCTGCTCATTCGTCTGCCGTGCACAGTGCAAGCGGCATTTCG
TGGACCTCGCACCAGTGCAGCTGTGGAGATTCGTGCCAGTGCGTGGGCTGTGCTGCACATCCCTACAATGACGCC
ACTCAGGATTACGTCCGCTCCGCATGGAACACCATGATGCAGGACGGCCAAAAGCTAAGCAATGGGACCCACACC
ACTGCCCATCTCAATGGCCATGGCGCCGACGGAAGCGCCAAGGACGGCAACGGTCGGACGACGGCCAGGACTGCC
AACGATGGCACAACGCACCCCGACGGCACCGTGTCTCCCCCGGCGCCCCAGACGCCATCCGACGGCACATCAGGC
ATCAACGAGGAGCAGACGCTCTCGGCCAATGACTTTTTCTTTGTCAGCTATCCCTTTGGCGACACGTGTGCTGGC
GAGACGGCGAGCTGTCCATGTGGTGATGACTGTCAATGCATTGGATGCGTAATTCACCACAATCCAGGCCCAGAA
CAAACAGATGGAAATGGGAGCGACAATCAGCATGCCTGA
Transcript >OphauG2|5531
ATGCCTCTGATCAATGGCCAGAAGATGGCTTGCGAGCCGTGTATTCGTGGCCATCGATCCACCAAATGCACTCAT
GCCAACGAACGCCTCATGGTACCCGTTCGAAAGCCCGGCCGCCCGTTGAGCTCGTGTCCACACCCTTCGTCGCGC
GCCTGCTCTTGCGCCGCCGTGACTGCAGCGATCCCGAGGAAACAAAAGTGTCGCTGCGGCAGTGCGCCCACGGCA
GCGGCCGAGAACGCCTCTCATGACAAGGAGCCGGACATGGCGCCGTCGAGCCCGTCCAAAGCTGCAGCAGCATCT
GGCTTCCGTGTCCAAAAGGCCGCGTCCAAGAGCGCGCCAAGCAGAAAACAGTCTGTTGATCCTAATGGGCTGGAA
AGAATGAACTCGAACCAGCTCAACATCTTGACGCAGTATAACAGCGCGCCCCGCGCCCCCTCGTTTTCCGACGGG
CCTTGTCCTTCGGCACCCGACATGTCTATTTACGGAGCCATGCAACTCACTCCGGCCGAATGCTCCTTTGGCTCC
GAGTCGACTCTGTTTTCTCCCGTCTTCCAGTTCCCGCTGCAGCCGTCCTCGGCGGGCGTTGGGCCAATCAAGCCT
GGGGCAAATGGCGGCTTCAGTCGCGGCGCAGTCGGCTCCATGGCCTCGAGGGTGACGCCCGTCGTGGAGAGCTGC
TGCACTGGCAGCACCAGCAGAGTGCAGGCCCAGACAAGTGCTCAGCTGGTGCAACCCCCATCGCCGGCTGACAAC
GGCTCTCGCGCAGACAAGCCCAAGGGGGGCTGCTGTTCCACTACAGACAAGGCAAAAGGCGCCAAGTCGCAGACG
GGCTCTCTACCCGCCGCCCCCAGTCTCGGTCAACAGGCGTCGAGCGGTGCCATCCTGTCATACCAGGCTTCCATG
ACGGTGCCCAATGCCGTGTACCCCTATTACTCGCAGCCCACCATCTACAACTACCCTCCGCAGTTTGGATCATTC
CTTCAACCCCTTCAGCCAGAACAGTGGAGACAATTCATGGCAACCATCAACTACGGCCAGTCTGTTGCCGCCGCG
CCTGGCTATGGCATGAATGCGCCGGGCTCTCCGTCTGCTCATTCGTCTGCCGTGCACAGTGCAAGCGGCATTTCG
TGGACCTCGCACCAGTGCAGCTGTGGAGATTCGTGCCAGTGCGTGGGCTGTGCTGCACATCCCTACAATGACGCC
ACTCAGGATTACGTCCGCTCCGCATGGAACACCATGATGCAGGACGGCCAAAAGCTAAGCAATGGGACCCACACC
ACTGCCCATCTCAATGGCCATGGCGCCGACGGAAGCGCCAAGGACGGCAACGGTCGGACGACGGCCAGGACTGCC
AACGATGGCACAACGCACCCCGACGGCACCGTGTCTCCCCCGGCGCCCCAGACGCCATCCGACGGCACATCAGGC
ATCAACGAGGAGCAGACGCTCTCGGCCAATGACTTTTTCTTTGTCAGCTATCCCTTTGGCGACACGTGTGCTGGC
GAGACGGCGAGCTGTCCATGTGGTGATGACTGTCAATGCATTGGATGCGTAATTCACCACAATCCAGGCCCAGAA
CAAACAGATGGAAATGGGAGCGACAATCAGCATGCCTGA
Gene >OphauG2|5531
ATGCCTCTGATCAATGGCCAGAAGATGGCTTGGTATGGATCCTCCCTGCCAAGTATTTTGCTCGTCGCTGGCGTG
CGCAGACTCTCGGGCTGACCATGGTGCGCATAGCGAGCCGTGTATTCGTGGCCATCGATCCACCAAATGCACTCA
TGCCAACGAACGCCTCATGGTACCCGTTCGAAAGCCCGGCCGCCCGTTGAGCTCGTGTCCACACCCTTCGTCGCG
CGCCTGCTCTTGCGCCGCCGTGACTGCAGCGATCCCGAGGAAACAAAAGTGTCGCTGCGGCAGTGCGCCCACGGC
AGCGGCCGAGAACGCCTCTCATGACAAGGAGCCGGACATGGCGCCGTCGAGCCCGTCCAAAGCTGCAGCAGCATC
TGGCTTCCGTGTCCAAAAGGCCGCGTCCAAGAGCGCGCCAAGCAGAAAACAGTCTGTTGATCCTAATGGGCTGGA
AAGAATGAACTCGAACCAGCTCAACATCTTGACGCAGTATAACAGCGCGCCCCGCGCCCCCTCGTTTTCCGACGG
GCCTTGTCCTTCGGCACCCGACATGTCTATTTACGGAGCCATGCAACTCACTCCGGCCGAATGCTCCTTTGGCTC
CGAGTCGACTCTGTTTTCTCCCGTCTTCCAGTTCCCGCTGCAGCCGTCCTCGGCGGGCGTTGGGCCAATCAAGCC
TGGGGCAAATGGCGGCTTCAGTCGCGGCGCAGTCGGCTCCATGGCCTCGAGGGTGACGCCCGTCGTGGAGAGCTG
CTGCACTGGCAGCACCAGCAGAGTGCAGGCCCAGACAAGTGCTCAGCTGGTGCAACCCCCATCGCCGGCTGACAA
CGGCTCTCGCGCAGACAAGCCCAAGGGGGGCTGCTGTTCCACTACAGACAAGGCAAAAGGCGCCAAGTCGCAGAC
GGGCTCTCTACCCGCCGCCCCCAGTCTCGGTCAACAGGCGTCGAGCGGTGCCATCCTGTCATACCAGGCTTCCAT
GACGGTGCCCAATGCCGTGTACCCCTATTACTCGCAGCCCACCATCTACAACTACCCTCCGCAGTTTGGATCATT
CCTTCAACCCCTTCAGCCAGAACAGTGGAGACAATTCATGGCAACCATCAACTACGGCCAGTCTGTTGCCGCCGC
GCCTGGCTATGGCATGAATGCGCCGGGCTCTCCGTCTGCTCATTCGTCTGCCGTGCACAGTGCAAGCGGCATTTC
GTGGACCTCGCACCAGTGCAGCTGTGGAGATTCGTGCCAGTGCGTGGGCTGTGCTGCACATCCCTACAATGACGC
CACTCAGGATTACGTCCGCTCCGCATGGAACACCATGATGCAGGACGGCCAAAAGCTAAGCAATGGGACCCACAC
CACTGCCCATCTCAATGGCCATGGCGCCGACGGAAGCGCCAAGGACGGCAACGGTCGGACGACGGCCAGGACTGC
CAACGATGGCACAACGCACCCCGACGGCACCGTGTCTCCCCCGGCGCCCCAGACGCCATCCGACGGCACATCAGG
CATCAACGAGGAGCAGACGCTCTCGGCCAATGACTTTTTCTTTGTCAGCTATCCCTTTGGCGACACGTGTGCTGG
CGAGACGGCGAGCTGTCCATGTGGTGATGACTGTCAATGCATTGGATGCGTAATTCACCACAATCCAGGCCCAGA
ACAAACAGATGGAAATGGGAGCGACAATCAGCATGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail