Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5519
Gene name
LocationContig_51:31631..33764
Strand-
Gene length (bp)2133
Transcript length (bp)2004
Coding sequence length (bp)2004
Protein length (aa) 668

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01363 FYVE FYVE zinc finger 9.7E-07 175 244
PF01363 FYVE FYVE zinc finger 7.8E-17 329 413
PF11464 Rbsn Rabenosyn Rab binding domain 2.9E-15 605 646

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P32609|PEP7_YEAST Vacuolar segregation protein PEP7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP7 PE=1 SV=2 121 650 7.0E-62
sp|O13786|PEP7_SCHPO Vacuolar segregation protein pep7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pep7 PE=3 SV=1 74 654 1.0E-52
sp|Q9H1K0|RBNS5_HUMAN Rabenosyn-5 OS=Homo sapiens GN=RBSN PE=1 SV=2 253 539 4.0E-12
sp|Q80Y56|RBNS5_MOUSE Rabenosyn-5 OS=Mus musculus GN=Rbsn PE=1 SV=1 253 539 5.0E-09

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5519
MSGRRLGGGRILGSGKGLAPPIATPSAAPRARSPFAPSDSSLSLGSHSLSPPVSISLTDPGPDIGSSVSLGTQAK
GTVAPSTDLVTLLQLNRHIDDNHQELPEHEQNEVNTWFDKQVLKAKRFQPLSLINQKLRGLDVFESNESSIPSSI
PHAAASSTSRADSFADPDDFITRSHWQRGTNSDRCTDPTCGKSLGSINGSINCRKCGKLFCEEHTMYQMKLSRSA
NHEPVRGYWSRVCETCYKSREGYNDHTGVSVDHTAMFAEMRRKRVERQKLEVSRLEKRLTKLTSLLADAPTTLAA
SNGGSLLAPVSSLMGQKDGRKLLEQSVVTWEEDEAVSKCPFCQQEFGSWTFRRHHCRICGHVVCADPLTACSSEV
SLNIKSPSSPRTEKALTNGESDQLHANIRMCRDCNHTIFSARDFAASLLYKPPDQRAYETLCQFERGIRLLLPSF
HRVLMALQPSKLSNGETDLSKPPPTHAQIQEAAKIRKRLIDSFGKYGAAAKRMRNLQTDKPSQKRLQEAVYTYAS
GFLHTNMLPLKSLPQMLRACSTASPIGRYMSTPTHSASNLRHTELATSSDVDSQAPSDEASTVVSQLESEEKELK
ERLAVLQEQKFLVQDMMRMATGARRFEEASALSRNIKELETEIDELSARVDQVEQRWEGVYGNGKPA*
Coding >OphauG2|5519
ATGTCTGGCCGGAGGCTCGGGGGCGGCCGCATCCTGGGCAGCGGCAAAGGCCTGGCGCCGCCCATAGCGACTCCG
TCGGCCGCCCCCCGAGCTCGCAGCCCCTTTGCTCCTTCGGATAGCTCCCTTTCCCTCGGCTCCCACTCTCTTTCG
CCGCCTGTCAGCATCAGCCTCACCGACCCGGGTCCGGACATTGGCTCCAGCGTCAGTCTGGGCACTCAGGCCAAG
GGCACCGTTGCCCCGTCGACGGACCTCGTGACGCTGTTGCAGCTCAATCGCCACATTGACGACAATCACCAGGAG
CTCCCTGAGCATGAGCAGAACGAAGTCAACACATGGTTCGACAAGCAAGTCCTCAAGGCCAAGCGTTTCCAGCCC
CTGTCGCTCATCAACCAGAAGCTTCGGGGACTAGACGTGTTCGAGTCCAACGAGTCCAGTATTCCTTCATCCATC
CCTCACGCCGCCGCGAGCAGCACATCACGCGCCGACAGTTTCGCCGACCCCGATGACTTCATCACAAGGAGCCAT
TGGCAGCGAGGCACCAACTCGGATCGATGCACAGATCCCACCTGTGGCAAGAGCCTGGGCTCCATCAATGGGAGC
ATAAACTGTCGAAAGTGCGGCAAGCTATTCTGCGAGGAGCACACCATGTATCAAATGAAGCTCAGTAGAAGCGCC
AACCACGAGCCTGTCAGGGGCTACTGGTCCCGCGTCTGCGAGACTTGCTACAAATCCAGAGAGGGCTATAATGAC
CACACTGGCGTCTCTGTCGACCACACAGCCATGTTTGCCGAGATGAGACGAAAGAGGGTAGAGCGACAGAAGCTG
GAAGTATCACGACTGGAAAAGCGCTTGACCAAGCTGACCAGTCTTTTGGCTGACGCTCCAACAACCTTGGCGGCC
TCAAACGGGGGCTCCTTATTGGCGCCCGTCTCGTCCTTGATGGGACAGAAAGATGGCCGTAAACTACTTGAGCAA
TCCGTCGTGACGTGGGAGGAGGATGAGGCCGTATCAAAGTGTCCCTTTTGCCAGCAAGAGTTTGGTTCCTGGACA
TTTCGGCGCCACCATTGCCGTATATGCGGCCACGTCGTGTGCGCAGACCCCTTGACAGCCTGCTCGTCTGAAGTC
AGCCTGAACATCAAGAGCCCCTCAAGTCCCAGGACCGAAAAGGCCTTGACCAACGGAGAGAGCGACCAACTGCAC
GCCAATATCAGGATGTGTAGGGATTGCAATCATACAATCTTCTCGGCCCGAGACTTTGCCGCCTCGCTGCTTTAC
AAGCCTCCGGATCAGCGAGCGTACGAGACTCTGTGCCAATTTGAGCGCGGCATTCGTCTGCTGCTGCCTTCCTTC
CACCGCGTTCTCATGGCTTTACAACCCAGCAAATTGAGCAATGGAGAAACAGATTTGAGCAAGCCTCCCCCGACC
CACGCGCAGATTCAAGAAGCAGCCAAGATACGGAAACGCCTGATTGACAGCTTTGGCAAATACGGCGCTGCGGCA
AAGAGGATGCGCAATCTCCAGACGGACAAGCCGTCTCAGAAACGACTACAAGAAGCCGTCTACACCTATGCCAGC
GGCTTTTTGCACACAAACATGCTGCCGCTAAAGAGCTTGCCGCAGATGCTGCGCGCATGCTCTACGGCTTCTCCC
ATTGGCCGCTACATGTCCACGCCCACTCACTCGGCCTCGAATCTGCGGCACACGGAGCTTGCCACCTCGTCCGAC
GTGGACTCGCAGGCACCCAGTGACGAAGCCAGCACTGTTGTCAGTCAGCTTGAATCGGAGGAGAAGGAGCTCAAG
GAGCGGCTGGCGGTGCTCCAGGAGCAAAAGTTTCTGGTGCAAGACATGATGCGCATGGCTACGGGCGCGCGTCGC
TTCGAAGAGGCGAGTGCCTTGTCGCGCAATATCAAGGAGCTCGAGACCGAGATTGATGAGCTAAGCGCAAGGGTT
GACCAGGTTGAGCAGAGGTGGGAGGGCGTCTATGGTAATGGCAAACCTGCTTGA
Transcript >OphauG2|5519
ATGTCTGGCCGGAGGCTCGGGGGCGGCCGCATCCTGGGCAGCGGCAAAGGCCTGGCGCCGCCCATAGCGACTCCG
TCGGCCGCCCCCCGAGCTCGCAGCCCCTTTGCTCCTTCGGATAGCTCCCTTTCCCTCGGCTCCCACTCTCTTTCG
CCGCCTGTCAGCATCAGCCTCACCGACCCGGGTCCGGACATTGGCTCCAGCGTCAGTCTGGGCACTCAGGCCAAG
GGCACCGTTGCCCCGTCGACGGACCTCGTGACGCTGTTGCAGCTCAATCGCCACATTGACGACAATCACCAGGAG
CTCCCTGAGCATGAGCAGAACGAAGTCAACACATGGTTCGACAAGCAAGTCCTCAAGGCCAAGCGTTTCCAGCCC
CTGTCGCTCATCAACCAGAAGCTTCGGGGACTAGACGTGTTCGAGTCCAACGAGTCCAGTATTCCTTCATCCATC
CCTCACGCCGCCGCGAGCAGCACATCACGCGCCGACAGTTTCGCCGACCCCGATGACTTCATCACAAGGAGCCAT
TGGCAGCGAGGCACCAACTCGGATCGATGCACAGATCCCACCTGTGGCAAGAGCCTGGGCTCCATCAATGGGAGC
ATAAACTGTCGAAAGTGCGGCAAGCTATTCTGCGAGGAGCACACCATGTATCAAATGAAGCTCAGTAGAAGCGCC
AACCACGAGCCTGTCAGGGGCTACTGGTCCCGCGTCTGCGAGACTTGCTACAAATCCAGAGAGGGCTATAATGAC
CACACTGGCGTCTCTGTCGACCACACAGCCATGTTTGCCGAGATGAGACGAAAGAGGGTAGAGCGACAGAAGCTG
GAAGTATCACGACTGGAAAAGCGCTTGACCAAGCTGACCAGTCTTTTGGCTGACGCTCCAACAACCTTGGCGGCC
TCAAACGGGGGCTCCTTATTGGCGCCCGTCTCGTCCTTGATGGGACAGAAAGATGGCCGTAAACTACTTGAGCAA
TCCGTCGTGACGTGGGAGGAGGATGAGGCCGTATCAAAGTGTCCCTTTTGCCAGCAAGAGTTTGGTTCCTGGACA
TTTCGGCGCCACCATTGCCGTATATGCGGCCACGTCGTGTGCGCAGACCCCTTGACAGCCTGCTCGTCTGAAGTC
AGCCTGAACATCAAGAGCCCCTCAAGTCCCAGGACCGAAAAGGCCTTGACCAACGGAGAGAGCGACCAACTGCAC
GCCAATATCAGGATGTGTAGGGATTGCAATCATACAATCTTCTCGGCCCGAGACTTTGCCGCCTCGCTGCTTTAC
AAGCCTCCGGATCAGCGAGCGTACGAGACTCTGTGCCAATTTGAGCGCGGCATTCGTCTGCTGCTGCCTTCCTTC
CACCGCGTTCTCATGGCTTTACAACCCAGCAAATTGAGCAATGGAGAAACAGATTTGAGCAAGCCTCCCCCGACC
CACGCGCAGATTCAAGAAGCAGCCAAGATACGGAAACGCCTGATTGACAGCTTTGGCAAATACGGCGCTGCGGCA
AAGAGGATGCGCAATCTCCAGACGGACAAGCCGTCTCAGAAACGACTACAAGAAGCCGTCTACACCTATGCCAGC
GGCTTTTTGCACACAAACATGCTGCCGCTAAAGAGCTTGCCGCAGATGCTGCGCGCATGCTCTACGGCTTCTCCC
ATTGGCCGCTACATGTCCACGCCCACTCACTCGGCCTCGAATCTGCGGCACACGGAGCTTGCCACCTCGTCCGAC
GTGGACTCGCAGGCACCCAGTGACGAAGCCAGCACTGTTGTCAGTCAGCTTGAATCGGAGGAGAAGGAGCTCAAG
GAGCGGCTGGCGGTGCTCCAGGAGCAAAAGTTTCTGGTGCAAGACATGATGCGCATGGCTACGGGCGCGCGTCGC
TTCGAAGAGGCGAGTGCCTTGTCGCGCAATATCAAGGAGCTCGAGACCGAGATTGATGAGCTAAGCGCAAGGGTT
GACCAGGTTGAGCAGAGGTGGGAGGGCGTCTATGGTAATGGCAAACCTGCTTGA
Gene >OphauG2|5519
ATGTCTGGCCGGAGGCTCGGGGGCGGCCGCATCCTGGGCAGCGGCAAAGGCCTGGCGCCGCCCATAGCGACTCCG
TCGGCCGCCCCCCGAGCTCGCAGCCCCTTTGCTCCTTCGGATAGCTCCCTTTCCCTCGGCTCCCACTCTCTTTCG
CCGCCTGTCAGCATCAGCCTCACCGACCCGGGTCCGGACATTGGCTCCAGCGTCAGTCTGGGCACTCAGGCCAAG
GGCACCGTTGCCCCGTCGACGGACCTCGTCTGTCCCATTTGCAATGAGGAAATGGCATGTGTGTCTTGCTTGCAT
GGCTCGGACCTGGTGCTGACCTGATGCTCACAGGTGACGCTGTTGCAGCTCAATCGCCACATTGACGACAATCAC
CAGGAGCTCCCTGAGCATGAGCAGAACGAAGTCAACACATGGTTCGACAAGCAAGTCCTCAAGGCCAAGCGTTTC
CAGCCCCTGTCGCTCATCAACCAGAAGCTTCGGGGACTAGACGTGTTCGAGTCCAACGAGTCCAGTATTCCTTCA
TCCATCCCTCACGCCGCCGCGAGCAGCACATCACGCGCCGACAGTTTCGCCGACCCCGATGACTTCATCACAAGG
AGCCATTGGCAGCGAGGCACCAACTCGGATCGATGCACAGATCCCACCTGTGGCAAGAGCCTGGGCTCCATCAAT
GGGAGCATAAACTGTCGAAAGTGCGGCAAGCTATTCTGCGAGGAGCACACCATGTATCAAATGAAGCTCAGTAGA
AGCGCCAACCACGAGCCTGTCAGGGGCTACTGGTCCCGCGTCTGCGAGACTTGCTACAAATCCAGAGAGGGCTAT
AATGACCACACTGGCGTCTCTGTCGACCACACAGCCATGTTTGCCGAGATGAGACGAAAGAGGGTAGAGCGACAG
AAGCTGGAAGTATCACGACTGGAAAAGCGCTTGACCAAGCTGACCAGTCTTTTGGCTGACGCTCCAACAACCTTG
GCGGCCTCAAACGGGGGCTCCTTATTGGCGCCCGTCTCGTCCTTGATGGGACAGAAAGATGGCCGTAAACTACTT
GAGCAATCCGTCGTGACGTGGGAGGAGGATGAGGCCGTATCAAAGTGTCCCTTTTGCCAGCAAGAGTTTGGTTCC
TGGACATTTCGGCGCCACCATTGCCGTATATGCGGCCACGTCGTGTGCGCAGACCCCTTGACAGCCTGCTCGTCT
GAAGTCAGCCTGAACATCAAGAGCCGTAAGTTGACTTTGCTGCGTTTGTCGAGACAGCACTAACTCGTCCCAGCC
TCAAGTCCCAGGACCGAAAAGGCCTTGACCAACGGAGAGAGCGACCAACTGCACGCCAATATCAGGATGTGTAGG
GATTGCAATCATACAATCTTCTCGGCCCGAGACTTTGCCGCCTCGCTGCTTTACAAGCCTCCGGATCAGCGAGCG
TACGAGACTCTGTGCCAATTTGAGCGCGGCATTCGTCTGCTGCTGCCTTCCTTCCACCGCGTTCTCATGGCTTTA
CAACCCAGCAAATTGAGCAATGGAGAAACAGATTTGAGCAAGCCTCCCCCGACCCACGCGCAGATTCAAGAAGCA
GCCAAGATACGGAAACGCCTGATTGACAGCTTTGGCAAATACGGCGCTGCGGCAAAGAGGATGCGCAATCTCCAG
ACGGACAAGCCGTCTCAGAAACGACTACAAGAAGCCGTCTACACCTATGCCAGCGGCTTTTTGCACACAAACATG
CTGCCGCTAAAGAGCTTGCCGCAGATGCTGCGCGCATGCTCTACGGCTTCTCCCATTGGCCGCTACATGTCCACG
CCCACTCACTCGGCCTCGAATCTGCGGCACACGGAGCTTGCCACCTCGTCCGACGTGGACTCGCAGGCACCCAGT
GACGAAGCCAGCACTGTTGTCAGTCAGCTTGAATCGGAGGAGAAGGAGCTCAAGGAGCGGCTGGCGGTGCTCCAG
GAGCAAAAGTTTCTGGTGCAAGACATGATGCGCATGGCTACGGGCGCGCGTCGCTTCGAAGAGGCGAGTGCCTTG
TCGCGCAATATCAAGGAGCTCGAGACCGAGATTGATGAGCTAAGCGCAAGGGTTGACCAGGTTGAGCAGAGGTGG
GAGGGCGTCTATGGTAATGGCAAACCTGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail