Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5510
Gene name
LocationContig_51:8673..10896
Strand-
Gene length (bp)2223
Transcript length (bp)2097
Coding sequence length (bp)2097
Protein length (aa) 699

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain 3.0E-08 22 190
PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain 1.4E-07 420 537
PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2 9.4E-06 345 379

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P77989|BGAL_THEP3 Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=lacZ PE=3 SV=2 126 502 1.0E-17
sp|P06864|BGA2_ECOLI Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) GN=ebgA PE=1 SV=4 144 535 7.0E-12
sp|A4W7D2|BGAL_ENT38 Beta-galactosidase OS=Enterobacter sp. (strain 638) GN=lacZ PE=3 SV=1 136 539 1.0E-11
sp|O97524|BGLR_FELCA Beta-glucuronidase OS=Felis catus GN=GUSB PE=1 SV=1 99 535 3.0E-11
sp|O18835|BGLR_CANLF Beta-glucuronidase OS=Canis lupus familiaris GN=GUSB PE=1 SV=1 99 535 5.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P77989|BGAL_THEP3 Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=lacZ PE=3 SV=2 126 502 1.0E-17
sp|P06864|BGA2_ECOLI Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) GN=ebgA PE=1 SV=4 144 535 7.0E-12
sp|A4W7D2|BGAL_ENT38 Beta-galactosidase OS=Enterobacter sp. (strain 638) GN=lacZ PE=3 SV=1 136 539 1.0E-11
sp|O97524|BGLR_FELCA Beta-glucuronidase OS=Felis catus GN=GUSB PE=1 SV=1 99 535 3.0E-11
sp|O18835|BGLR_CANLF Beta-glucuronidase OS=Canis lupus familiaris GN=GUSB PE=1 SV=1 99 535 5.0E-11
sp|A3FEW8|BGAL_ENTAG Beta-galactosidase OS=Enterobacter agglomerans GN=lacZ PE=1 SV=2 136 539 1.0E-10
sp|P05804|BGLR_ECOLI Beta-glucuronidase OS=Escherichia coli (strain K12) GN=uidA PE=1 SV=2 104 598 3.0E-10
sp|A9R0J8|BGAL_YERPG Beta-galactosidase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=lacZ PE=3 SV=1 16 539 5.0E-09
sp|A7FH78|BGAL_YERP3 Beta-galactosidase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=lacZ PE=3 SV=1 16 539 5.0E-09
sp|B1JI86|BGAL_YERPY Beta-galactosidase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=lacZ PE=3 SV=1 16 539 5.0E-09
sp|Q669R9|BGAL_YERPS Beta-galactosidase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=lacZ PE=3 SV=1 16 539 5.0E-09
sp|B2K6E6|BGAL_YERPB Beta-galactosidase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=lacZ PE=3 SV=1 16 539 5.0E-09
sp|Q1CI76|BGAL_YERPN Beta-galactosidase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=lacZ PE=3 SV=1 16 539 6.0E-09
sp|A0KQH4|BGAL_AERHH Beta-galactosidase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=lacZ PE=3 SV=1 24 539 6.0E-09
sp|Q1C6T8|BGAL_YERPA Beta-galactosidase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=lacZ PE=3 SV=1 16 539 6.0E-09
sp|Q7CIZ3|BGAL_YERPE Beta-galactosidase OS=Yersinia pestis GN=lacZ PE=3 SV=1 16 539 6.0E-09
sp|A4TLL5|BGAL_YERPP Beta-galactosidase OS=Yersinia pestis (strain Pestoides F) GN=lacZ PE=3 SV=1 16 539 6.0E-09
sp|A1SWB8|BGAL_PSYIN Beta-galactosidase OS=Psychromonas ingrahamii (strain 37) GN=lacZ PE=3 SV=1 347 549 3.0E-08
sp|B2VHN8|BGAL_ERWT9 Beta-galactosidase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=lacZ PE=3 SV=1 143 539 4.0E-08
sp|P81650|BGAL_PSEHA Beta-galactosidase OS=Pseudoalteromonas haloplanktis GN=lacZ PE=1 SV=2 347 534 3.0E-07
sp|Q7MG04|BGAL_VIBVY Beta-galactosidase OS=Vibrio vulnificus (strain YJ016) GN=lacZ PE=3 SV=1 347 539 9.0E-07
sp|Q8D4H3|BGAL_VIBVU Beta-galactosidase OS=Vibrio vulnificus (strain CMCP6) GN=lacZ PE=3 SV=2 347 539 1.0E-06
sp|A1JTC4|BGAL_YERE8 Beta-galactosidase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=lacZ PE=3 SV=1 346 539 1.0E-06
sp|Q04F24|BGAL_OENOB Beta-galactosidase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=lacZ PE=3 SV=1 319 534 2.0E-06
sp|A8GGN3|BGAL_SERP5 Beta-galactosidase OS=Serratia proteamaculans (strain 568) GN=lacZ PE=3 SV=1 345 539 3.0E-06
sp|Q48727|BGAL_LACLA Beta-galactosidase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lacZ PE=3 SV=3 346 539 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5510
MSPPVPQPYPRPDFQRPDLSWQSLNGTWSFIFDDADEGLVKHWAQSGLPEIAHGATPPHAARDAGVQPEGQDITQ
RIAAGTQDLIKDNHLISATSAAPSNKRLSIKVPFVFQCPASGINDRGVHEVLWYQRDITDLRTSQQRLQGQRLLL
RFGAVDYEARVWLDGRFLAAHTGGHVPFDIDVTDAIDAEADAKSHRLILRVFDSAYDLTQPRGKQYWGAKPESIF
YTPSGGIWQSVWLEVVPPMRIAHGTHGTVIRSDDIESGNLDCHIAVLGRRQGQPCSVQIEATFGGQSVATSDVMM
LAKDRNSVHVDLCLRLSPDQQSKLPSSIVDAAPLDKDDCWRHGLALWSPEHPLLYELDIRLFDASHQIVDQVKTW
TGMRSINWTQGDGLWRLNGKPYFQALCLDQGYWPDSFMTPPGPDSIKLDIELAKRMGFNGCRKHQKVEDPSFYYW
ADKLGYLVWAEMANSYQFSLEYVDRFNQEWTESVRLAINHASVVTWTPINESWGYPSLKDSAEQQNHIRALYYMT
KTLDPTRSINDNCGWEHVCTDLTTFHDYSDGPELAKTCASHDLILGPKADNRGLFVASARHQAGAPVMCTEFGGV
NIAPTGKAGEGASSDRDWGYTTATNAQDLLARFERLVKGVANGGHCCAFVYTQLTDIEQEANGLYSFDRKEKLEA
AKVKAVIDEAVQSFYQRLEQTSS*
Coding >OphauG2|5510
ATGTCTCCGCCCGTGCCCCAGCCCTATCCACGCCCCGACTTCCAGCGACCCGACCTGTCATGGCAATCGCTCAAC
GGCACTTGGAGCTTCATTTTCGACGATGCCGATGAGGGCCTGGTCAAGCACTGGGCCCAGTCTGGCCTCCCCGAA
ATTGCTCATGGCGCCACGCCACCACACGCCGCCCGTGATGCGGGCGTCCAGCCAGAGGGCCAAGACATTACCCAA
CGCATCGCTGCCGGCACCCAGGACCTCATCAAGGACAATCACCTGATATCGGCCACGTCGGCTGCCCCATCCAAT
AAGCGTCTCTCCATCAAGGTTCCTTTTGTCTTCCAGTGCCCTGCCTCAGGCATCAATGACCGGGGCGTCCACGAG
GTGCTCTGGTATCAACGAGACATTACCGACCTGCGTACCTCGCAACAGAGGCTCCAGGGTCAGAGGCTACTGCTT
CGATTTGGTGCTGTCGACTATGAGGCTCGCGTCTGGCTCGACGGCCGTTTCCTCGCTGCCCACACTGGTGGCCAT
GTCCCCTTTGACATTGATGTCACGGATGCCATTGACGCTGAAGCCGACGCAAAGTCGCATCGTCTCATACTAAGG
GTCTTTGATTCCGCCTATGATCTGACTCAGCCGCGTGGAAAACAGTACTGGGGTGCAAAGCCCGAGAGCATCTTT
TACACTCCTTCCGGCGGCATTTGGCAGTCTGTCTGGCTCGAGGTTGTTCCGCCCATGAGAATCGCTCATGGAACC
CACGGTACTGTCATTCGTTCTGACGATATTGAGTCGGGCAACCTTGACTGTCATATTGCGGTTCTGGGTCGACGC
CAGGGGCAGCCATGTTCAGTTCAAATCGAGGCAACCTTTGGTGGCCAGTCGGTGGCAACATCCGATGTGATGATG
CTTGCCAAGGACAGGAACTCGGTCCATGTTGACTTGTGTTTGCGTCTGTCTCCAGATCAACAGTCTAAACTGCCC
TCGTCTATTGTCGATGCTGCGCCTCTGGACAAGGACGACTGCTGGCGTCATGGCTTGGCTCTTTGGTCTCCTGAG
CATCCCCTCCTCTATGAGCTCGACATTCGCCTTTTTGACGCCTCGCATCAGATTGTTGACCAAGTCAAGACTTGG
ACAGGCATGCGTTCCATCAACTGGACCCAGGGCGATGGCCTTTGGAGACTCAACGGCAAGCCTTACTTTCAAGCC
TTGTGCTTGGATCAAGGCTACTGGCCCGACAGCTTCATGACGCCACCAGGTCCTGACAGCATAAAACTCGACATC
GAGTTGGCCAAACGCATGGGCTTCAATGGCTGTCGCAAGCATCAAAAGGTGGAGGATCCCTCATTTTACTACTGG
GCCGACAAGCTGGGCTATCTTGTCTGGGCAGAAATGGCCAATTCGTACCAGTTTAGTCTCGAGTATGTGGACCGT
TTTAACCAAGAATGGACCGAATCCGTCAGGCTTGCAATCAACCATGCTTCGGTTGTGACGTGGACCCCTATCAAT
GAGAGCTGGGGCTATCCGTCGCTCAAGGACAGTGCAGAGCAGCAGAACCACATTCGAGCGCTATACTACATGACC
AAGACCCTGGACCCTACGAGAAGCATCAATGACAATTGCGGCTGGGAGCATGTTTGCACCGACCTGACGACATTC
CATGACTACAGCGATGGCCCCGAGCTGGCCAAAACGTGCGCCAGCCATGACCTCATCCTCGGACCCAAGGCAGAC
AACAGGGGCCTGTTTGTTGCATCGGCCAGGCACCAGGCGGGCGCTCCGGTTATGTGTACCGAGTTTGGGGGAGTC
AATATTGCGCCTACTGGCAAAGCCGGCGAGGGCGCCAGCTCTGACCGGGACTGGGGCTACACAACGGCGACCAAT
GCTCAAGACCTATTGGCCAGGTTTGAGCGCCTCGTCAAGGGCGTGGCAAACGGAGGCCACTGTTGTGCATTTGTT
TACACACAGCTAACCGACATTGAGCAAGAGGCAAATGGGCTCTACAGCTTTGATCGCAAGGAAAAGTTGGAGGCA
GCCAAAGTCAAGGCGGTTATTGATGAAGCGGTGCAGTCGTTTTATCAGCGACTCGAGCAGACTTCTTCGTAG
Transcript >OphauG2|5510
ATGTCTCCGCCCGTGCCCCAGCCCTATCCACGCCCCGACTTCCAGCGACCCGACCTGTCATGGCAATCGCTCAAC
GGCACTTGGAGCTTCATTTTCGACGATGCCGATGAGGGCCTGGTCAAGCACTGGGCCCAGTCTGGCCTCCCCGAA
ATTGCTCATGGCGCCACGCCACCACACGCCGCCCGTGATGCGGGCGTCCAGCCAGAGGGCCAAGACATTACCCAA
CGCATCGCTGCCGGCACCCAGGACCTCATCAAGGACAATCACCTGATATCGGCCACGTCGGCTGCCCCATCCAAT
AAGCGTCTCTCCATCAAGGTTCCTTTTGTCTTCCAGTGCCCTGCCTCAGGCATCAATGACCGGGGCGTCCACGAG
GTGCTCTGGTATCAACGAGACATTACCGACCTGCGTACCTCGCAACAGAGGCTCCAGGGTCAGAGGCTACTGCTT
CGATTTGGTGCTGTCGACTATGAGGCTCGCGTCTGGCTCGACGGCCGTTTCCTCGCTGCCCACACTGGTGGCCAT
GTCCCCTTTGACATTGATGTCACGGATGCCATTGACGCTGAAGCCGACGCAAAGTCGCATCGTCTCATACTAAGG
GTCTTTGATTCCGCCTATGATCTGACTCAGCCGCGTGGAAAACAGTACTGGGGTGCAAAGCCCGAGAGCATCTTT
TACACTCCTTCCGGCGGCATTTGGCAGTCTGTCTGGCTCGAGGTTGTTCCGCCCATGAGAATCGCTCATGGAACC
CACGGTACTGTCATTCGTTCTGACGATATTGAGTCGGGCAACCTTGACTGTCATATTGCGGTTCTGGGTCGACGC
CAGGGGCAGCCATGTTCAGTTCAAATCGAGGCAACCTTTGGTGGCCAGTCGGTGGCAACATCCGATGTGATGATG
CTTGCCAAGGACAGGAACTCGGTCCATGTTGACTTGTGTTTGCGTCTGTCTCCAGATCAACAGTCTAAACTGCCC
TCGTCTATTGTCGATGCTGCGCCTCTGGACAAGGACGACTGCTGGCGTCATGGCTTGGCTCTTTGGTCTCCTGAG
CATCCCCTCCTCTATGAGCTCGACATTCGCCTTTTTGACGCCTCGCATCAGATTGTTGACCAAGTCAAGACTTGG
ACAGGCATGCGTTCCATCAACTGGACCCAGGGCGATGGCCTTTGGAGACTCAACGGCAAGCCTTACTTTCAAGCC
TTGTGCTTGGATCAAGGCTACTGGCCCGACAGCTTCATGACGCCACCAGGTCCTGACAGCATAAAACTCGACATC
GAGTTGGCCAAACGCATGGGCTTCAATGGCTGTCGCAAGCATCAAAAGGTGGAGGATCCCTCATTTTACTACTGG
GCCGACAAGCTGGGCTATCTTGTCTGGGCAGAAATGGCCAATTCGTACCAGTTTAGTCTCGAGTATGTGGACCGT
TTTAACCAAGAATGGACCGAATCCGTCAGGCTTGCAATCAACCATGCTTCGGTTGTGACGTGGACCCCTATCAAT
GAGAGCTGGGGCTATCCGTCGCTCAAGGACAGTGCAGAGCAGCAGAACCACATTCGAGCGCTATACTACATGACC
AAGACCCTGGACCCTACGAGAAGCATCAATGACAATTGCGGCTGGGAGCATGTTTGCACCGACCTGACGACATTC
CATGACTACAGCGATGGCCCCGAGCTGGCCAAAACGTGCGCCAGCCATGACCTCATCCTCGGACCCAAGGCAGAC
AACAGGGGCCTGTTTGTTGCATCGGCCAGGCACCAGGCGGGCGCTCCGGTTATGTGTACCGAGTTTGGGGGAGTC
AATATTGCGCCTACTGGCAAAGCCGGCGAGGGCGCCAGCTCTGACCGGGACTGGGGCTACACAACGGCGACCAAT
GCTCAAGACCTATTGGCCAGGTTTGAGCGCCTCGTCAAGGGCGTGGCAAACGGAGGCCACTGTTGTGCATTTGTT
TACACACAGCTAACCGACATTGAGCAAGAGGCAAATGGGCTCTACAGCTTTGATCGCAAGGAAAAGTTGGAGGCA
GCCAAAGTCAAGGCGGTTATTGATGAAGCGGTGCAGTCGTTTTATCAGCGACTCGAGCAGACTTCTTCGTAG
Gene >OphauG2|5510
ATGTCTCCGCCCGTGCCCCAGCCCTATCCACGCCCCGACTTCCAGCGACCCGACCTGTCATGGCAATCGCTCAAC
GGCACTTGGAGCTTCATTTTCGACGATGCCGATGAGGGCCTGGTCAAGCACTGGGCCCAGTCTGGCCTCCCCGAA
ATTGCTCATGGCGCCACGCCACCACACGCCGCCCGTGATGCGGGCGTCCAGCCAGAGGGCCAAGACATTACCCAA
CGCATCGCTGCCGGCACCCAGGACCTCATCAAGGACAATCACCTGATATCGGCCACGTCGGCTGCCCCATCCAAT
AAGCGTCTCTCCATCAAGGTTCCTTTTGTCTTCCAGTGCCCTGCCTCAGGCATCAATGACCGGGGCGTCCACGAG
GTGCTCTGGTATCAACGAGACATTACCGACCTGCGTACCTCGCAACAGAGGCTCCAGGGTCAGAGGCTACTGCTT
CGATTTGGTGCTGTCGACTATGAGGCTCGCGTCTGGCTCGACGGCCGTTTCCTCGCTGCCCACACTGGTGGCCAT
GTCCCCTTTGACATTGATGTCACGGATGCCATTGACGCTGAAGCCGACGCAAAGTCGCATCGTCTCATACTAAGG
GTCTTTGATTCCGCCTATGATCTGACTCAGCCGCGTGGAAAACAGTACTGGGGTGCAAAGCCCGAGAGCATCTTT
TACACTCCTTCCGGCGGCATTTGGCAGTCTGTCTGGCTCGAGGTTGTTCCGCCCATGAGAATCGCTCATGGAACC
CACGGTACTGTCATTCGTTCTGACGATATTGAGTCGGGCAACCTTGACTGTCATATTGCGGTTCTGGGTCGACGC
CAGGGGCAGCCATGTTCAGTTCAAATCGAGGCAACCTTTGGTGGCCAGTCGGTGGCAACATCCGATGTGATGATG
CTTGCCAAGGACAGGAACTCGGTCCATGTTGACTTGTGTTTGCGTCTGTCTCCAGATCAACAGTCTAAACTGCCC
TCGTCTATTGTCGATGCTGCGCCTCTGGACAAGGACGACTGCTGGCGTCATGGCTTGGCTCTTTGGTCTCCTGAG
CATCCCCTCCTCTATGAGCTCGACATTCGCCTTTTTGACGCCTCGCATCAGATTGTTGACCAAGTCAAGACTTGG
ACAGGCATGCGTTCCATCAACTGGACCCAGGGCGATGGCCTTTGGAGACTCAACGGCAAGCCTTACTTTCAAGCC
TTGTGCTTGGATCAAGGCTACTGGCCCGACAGCTTCATGACGCCACCAGGTCCTGACAGCATAAAACTCGACATC
GAGTTGGCCAAACGCATGGGCTTCAATGGCTGTCGCAAGCATCAAAAGGTGGAGGATCCCTCATTTTACTACTGG
GCCGACAAGCTGGGCTATCTTGTCTGGGCAGAAATGGCCAATTCGTACCAGTTTAGTCTCGAGTATGTGGACCGT
TTTAACCAAGAATGGACCGAATCCGTCAGGCTTGCAATCAACCATGCTTCGGTTGTGACGTGGACCCCTATCAAT
GAGAGCTGGGGCTATCCGTCGCTCAAGGACAGTGCAGAGCAGCAGAACCACATTCGAGCGCTATACTACATGACC
AAGTGAGCAATCAACAGTCTTGTTTGTCGCGCCACTATTAACAAATTACTACCAGGACCCTGGACCCTACGAGAA
GCATCAATGACAATTGCGGCTGGGAGCATGTTTGCACCGACCTGACGACATTCCATGACTACAGCGATGGCCCCG
AGCTGGCCAAAACGTGCGCCAGCCATGACCTCATCCTCGGACCCAAGGCAGACAACAGGGGCCTGTTTGTTGCAT
CGGCCAGGCACCAGGCGGGCGCTCCGGTTATGTGTACCGAGTTTGGGGGAGTCAATATTGCGCCTACTGGCAAAG
CCGGCGAGGGCGCCAGCTCTGACCGGGACTGGGGCTACACAACGGCGACCAATGCTCAAGACCTATTGGCCAGGT
TTGAGCGCCTCGTCAAGGGCGTGGCAAACGGAGGCCACTGTTGTGCATTTGTTTACACACAGCTGTATGTCTGAC
GTCCGTGTGCCATGTCTCAGGCGCTGTCTCTCTGACCAGAGCCACCACTGACTGTGCTCCAGAACCGACATTGAG
CAAGAGGCAAATGGGCTCTACAGCTTTGATCGCAAGGAAAAGTTGGAGGCAGCCAAAGTCAAGGCGGTTATTGAT
GAAGCGGTGCAGTCGTTTTATCAGCGACTCGAGCAGACTTCTTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail