Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5507
Gene name
LocationContig_51:1133..2342
Strand-
Gene length (bp)1209
Transcript length (bp)1110
Coding sequence length (bp)1110
Protein length (aa) 370

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04921 XAP5 XAP5, circadian clock regulator 1.0E-90 97 355

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q299F9|FAM50_DROPS Protein FAM50 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA11514 PE=3 SV=1 7 359 3.0E-25
sp|Q16U25|FAM50_AEDAE Protein FAM50 homolog OS=Aedes aegypti GN=AAEL010045 PE=3 SV=1 7 359 5.0E-25
sp|Q7LKZ5|FAM50_SCHPO FAM50 family protein C1020.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=xap5 PE=3 SV=2 16 353 3.0E-24
sp|Q2VPH1|F50AA_XENLA Protein FAM50A-A OS=Xenopus laevis GN=fam50a-a PE=2 SV=1 183 352 9.0E-24
sp|Q9WV03|FA50A_MOUSE Protein FAM50A OS=Mus musculus GN=Fam50a PE=1 SV=1 177 352 1.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q299F9|FAM50_DROPS Protein FAM50 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA11514 PE=3 SV=1 7 359 3.0E-25
sp|Q16U25|FAM50_AEDAE Protein FAM50 homolog OS=Aedes aegypti GN=AAEL010045 PE=3 SV=1 7 359 5.0E-25
sp|Q7LKZ5|FAM50_SCHPO FAM50 family protein C1020.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=xap5 PE=3 SV=2 16 353 3.0E-24
sp|Q2VPH1|F50AA_XENLA Protein FAM50A-A OS=Xenopus laevis GN=fam50a-a PE=2 SV=1 183 352 9.0E-24
sp|Q9WV03|FA50A_MOUSE Protein FAM50A OS=Mus musculus GN=Fam50a PE=1 SV=1 177 352 1.0E-23
sp|Q568K9|FA50A_DANRE Protein FAM50A OS=Danio rerio GN=fam50a PE=2 SV=1 183 352 1.0E-23
sp|Q9VAY7|FAM50_DROME Protein FAM50 homolog OS=Drosophila melanogaster GN=CG12259 PE=2 SV=1 3 359 1.0E-23
sp|Q7PYQ5|FAM50_ANOGA Protein FAM50 homolog OS=Anopheles gambiae GN=AGAP002062 PE=3 SV=2 7 359 2.0E-23
sp|Q28BK4|FA50A_XENTR Protein FAM50A OS=Xenopus tropicalis GN=fam50a PE=2 SV=2 183 352 2.0E-23
sp|Q14320|FA50A_HUMAN Protein FAM50A OS=Homo sapiens GN=FAM50A PE=1 SV=2 177 352 2.0E-23
sp|Q4KLV7|F50AB_XENLA Protein FAM50A-B OS=Xenopus laevis GN=fam50a-b PE=2 SV=1 183 352 6.0E-23
sp|Q4R846|FA50B_MACFA Protein FAM50B OS=Macaca fascicularis GN=FAM50B PE=2 SV=1 177 352 5.0E-22
sp|Q9WTJ8|FA50B_MOUSE Protein FAM50B OS=Mus musculus GN=Fam50b PE=2 SV=1 1 352 2.0E-21
sp|Q9Y247|FA50B_HUMAN Protein FAM50B OS=Homo sapiens GN=FAM50B PE=1 SV=1 177 352 2.0E-20
sp|Q8H110|XCT_ARATH Protein XAP5 CIRCADIAN TIMEKEEPER OS=Arabidopsis thaliana GN=XCT PE=1 SV=1 87 352 5.0E-19
sp|A8WXX7|FAM50_CAEBR Protein FAM50 homolog OS=Caenorhabditis briggsae GN=CBG04561 PE=3 SV=1 7 352 3.0E-18
sp|Q69JZ7|XCT_ORYSJ Protein XAP5 CIRCADIAN TIMEKEEPER OS=Oryza sativa subsp. japonica GN=XCT PE=2 SV=1 175 352 4.0E-18
sp|B8BDW1|XCT_ORYSI Protein XAP5 CIRCADIAN TIMEKEEPER OS=Oryza sativa subsp. indica GN=XCT PE=3 SV=1 175 352 4.0E-18
sp|Q18691|FAM50_CAEEL Protein FAM50 homolog OS=Caenorhabditis elegans GN=C47E8.4 PE=3 SV=3 149 353 7.0E-18
sp|Q54S94|FAM50_DICDI Protein FAM50 homolog OS=Dictyostelium discoideum GN=fam50 PE=3 SV=1 177 355 5.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0043229 intracellular organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043226 organelle No
GO:0043227 membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2973
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5507 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1875
Ophiocordyceps camponoti-floridani Ophcf2|05539
Ophiocordyceps camponoti-rufipedis Ophun1|3770
Ophiocordyceps kimflemingae Ophio5|7988
Ophiocordyceps subramaniannii Hirsu2|5065

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5507
MADPSASRFAPQNKSTHERLSTNTVGLVALSDYRKRRAEVLEQQERESREAALSATRVATPDSPHTPTPEGAGSK
SPAHSQSQLAQRNKKKQKLRPSNKLLSFDHGDYDDPDASDPSASNSEAKGNDSKSPPNGGQGSDPTTTGPKFKPN
ASVAVMPKVVTKAALRKEAAEREALRREFLAIQEAVKACEIAIPFVFYDGVNTPGGTVRIKKGDFVWVFLDKSRK
LAAQRVAVGEHRAPRRSWARVGVDDLMLVRDTVIIPHHYDFYFFIMNKSLGPSGRLLFDYSSQAPAKPPNEATGL
SNPALPAVETEALEGASDNAIVTKVVDRRWYERNKHIYPASTWQEFDPEKDFAGQIAKDTGGNTFFFAR*
Coding >OphauG2|5507
ATGGCCGACCCCTCGGCGTCTCGCTTTGCGCCGCAGAACAAGTCGACCCATGAGCGCCTCTCCACAAACACTGTC
GGCCTCGTCGCCCTGTCCGACTATCGCAAGCGACGCGCCGAGGTGCTGGAGCAGCAGGAGCGCGAATCCCGCGAG
GCCGCTCTCTCGGCCACTCGAGTAGCCACGCCCGACTCGCCTCACACGCCCACGCCTGAAGGAGCCGGCAGCAAG
TCACCCGCCCATTCCCAGTCCCAGCTGGCCCAGAGGAACAAGAAGAAGCAGAAGCTGCGGCCGAGCAATAAGCTG
CTTTCCTTTGACCATGGCGACTACGACGACCCCGACGCCTCTGACCCATCTGCCTCGAACTCTGAAGCAAAGGGC
AACGACTCCAAATCTCCGCCAAATGGGGGCCAGGGCTCCGATCCCACCACGACTGGTCCCAAATTCAAGCCCAAT
GCCTCGGTGGCTGTAATGCCCAAAGTTGTCACAAAGGCGGCCCTGCGCAAAGAGGCAGCAGAGCGAGAGGCTCTT
CGTCGCGAGTTTCTGGCAATTCAAGAGGCAGTCAAGGCGTGCGAGATTGCCATTCCCTTTGTATTTTACGATGGT
GTCAATACCCCAGGCGGTACTGTGCGTATCAAAAAGGGAGATTTTGTCTGGGTCTTTCTCGACAAGAGCCGCAAG
CTGGCTGCTCAGCGTGTCGCCGTCGGCGAACATCGCGCCCCAAGGCGCTCATGGGCACGCGTCGGCGTCGACGAT
CTCATGCTGGTGCGAGACACCGTCATCATTCCTCATCACTATGATTTTTACTTCTTCATCATGAACAAGAGTCTG
GGACCCAGTGGCCGTCTTCTCTTCGACTACAGCTCCCAGGCCCCTGCCAAACCACCCAACGAAGCGACTGGCTTG
TCCAACCCAGCACTGCCCGCTGTTGAAACCGAGGCCCTCGAGGGCGCATCCGACAATGCCATTGTAACAAAAGTG
GTGGATCGTCGATGGTATGAGCGCAACAAGCACATATACCCGGCCAGCACGTGGCAAGAGTTTGATCCAGAAAAG
GATTTTGCCGGCCAAATTGCAAAGGACACTGGTGGCAACACCTTCTTCTTTGCGCGGTGA
Transcript >OphauG2|5507
ATGGCCGACCCCTCGGCGTCTCGCTTTGCGCCGCAGAACAAGTCGACCCATGAGCGCCTCTCCACAAACACTGTC
GGCCTCGTCGCCCTGTCCGACTATCGCAAGCGACGCGCCGAGGTGCTGGAGCAGCAGGAGCGCGAATCCCGCGAG
GCCGCTCTCTCGGCCACTCGAGTAGCCACGCCCGACTCGCCTCACACGCCCACGCCTGAAGGAGCCGGCAGCAAG
TCACCCGCCCATTCCCAGTCCCAGCTGGCCCAGAGGAACAAGAAGAAGCAGAAGCTGCGGCCGAGCAATAAGCTG
CTTTCCTTTGACCATGGCGACTACGACGACCCCGACGCCTCTGACCCATCTGCCTCGAACTCTGAAGCAAAGGGC
AACGACTCCAAATCTCCGCCAAATGGGGGCCAGGGCTCCGATCCCACCACGACTGGTCCCAAATTCAAGCCCAAT
GCCTCGGTGGCTGTAATGCCCAAAGTTGTCACAAAGGCGGCCCTGCGCAAAGAGGCAGCAGAGCGAGAGGCTCTT
CGTCGCGAGTTTCTGGCAATTCAAGAGGCAGTCAAGGCGTGCGAGATTGCCATTCCCTTTGTATTTTACGATGGT
GTCAATACCCCAGGCGGTACTGTGCGTATCAAAAAGGGAGATTTTGTCTGGGTCTTTCTCGACAAGAGCCGCAAG
CTGGCTGCTCAGCGTGTCGCCGTCGGCGAACATCGCGCCCCAAGGCGCTCATGGGCACGCGTCGGCGTCGACGAT
CTCATGCTGGTGCGAGACACCGTCATCATTCCTCATCACTATGATTTTTACTTCTTCATCATGAACAAGAGTCTG
GGACCCAGTGGCCGTCTTCTCTTCGACTACAGCTCCCAGGCCCCTGCCAAACCACCCAACGAAGCGACTGGCTTG
TCCAACCCAGCACTGCCCGCTGTTGAAACCGAGGCCCTCGAGGGCGCATCCGACAATGCCATTGTAACAAAAGTG
GTGGATCGTCGATGGTATGAGCGCAACAAGCACATATACCCGGCCAGCACGTGGCAAGAGTTTGATCCAGAAAAG
GATTTTGCCGGCCAAATTGCAAAGGACACTGGTGGCAACACCTTCTTCTTTGCGCGGTGA
Gene >OphauG2|5507
ATGGCCGACCCCTCGGCGTCTCGCTTTGCGCCGCAGAACAAGTCGACCCATGAGCGCCTCTCCACAAACACTGTC
GGCCTCGTCGCCCTGTCCGACTATCGCAAGCGACGCGCCGAGGTGCTGGAGCAGCAGGAGCGCGAATCCCGCGAG
GCCGCTCTCTCGGCCACTCGAGTAGCCACGCCCGACTCGCCTCACACGCCCACGCCTGAAGGAGCCGGCAGCAAG
TCACCCGCCCATTCCCAGTCCCAGCTGGCCCAGAGGAACAAGAAGAAGCAGAAGCTGCGGCCGAGCAATAAGCTG
CTTTCCTTTGACCATGGCGACTACGACGACCCCGACGCCTCTGACCCATCTGCCTCGAACTCTGAAGCAAAGGGC
AACGACTCCAAATCTCCGCCAAATGGGGGCCAGGGCTCCGATCCCACCACGACTGGTCCCAAATTCAAGCCCAAT
GCCTCGGTGGCTGTAATGCCCAAAGTTGTCACAAAGGCGGCCCTGCGCAAAGAGGCAGCAGAGCGAGAGGCTCTT
CGTCGCGAGTTTCTGGCAATTCAAGAGGCAGTCAAGGCGTGCGAGATTGCCATTCCCTTTGTATTTTACGATGGT
GTCAATACCCCAGGCGGTACTGTGCGTATCAAAAAGGGAGATTTTGTCTGGGTCTTTCTCGACAAGAGCCGCAAG
CTGGCTGCTCAGCGTGTCGCCGTCGGCGAACATCGCGCCCCAAGGCGCTCATGGGCACGCGTCGGCGTCGACGAT
CTCATGCTGGTGCGAGACACCGTCATCATTCCTCATGTATGTCTAATCTATTCATCTGCGCTTGCTAACGCTCCT
ACCCAAAAAGAATAAAAAAAGTACAAGCTTGATTACGCGCTAACATGACTTTGCGCCAAGCACTATGATTTTTAC
TTCTTCATCATGAACAAGAGTCTGGGACCCAGTGGCCGTCTTCTCTTCGACTACAGCTCCCAGGCCCCTGCCAAA
CCACCCAACGAAGCGACTGGCTTGTCCAACCCAGCACTGCCCGCTGTTGAAACCGAGGCCCTCGAGGGCGCATCC
GACAATGCCATTGTAACAAAAGTGGTGGATCGTCGATGGTATGAGCGCAACAAGCACATATACCCGGCCAGCACG
TGGCAAGAGTTTGATCCAGAAAAGGATTTTGCCGGCCAAATTGCAAAGGACACTGGTGGCAACACCTTCTTCTTT
GCGCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail