Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5506
Gene name
LocationContig_509:11409..13086
Strand-
Gene length (bp)1677
Transcript length (bp)1392
Coding sequence length (bp)1392
Protein length (aa) 464

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01053 Cys_Met_Meta_PP Cys/Met metabolism PLP-dependent enzyme 1.2E-136 9 432
PF01041 DegT_DnrJ_EryC1 DegT/DnrJ/EryC1/StrS aminotransferase family 3.3E-08 68 191
PF00155 Aminotran_1_2 Aminotransferase class I and II 1.4E-07 71 236
PF00266 Aminotran_5 Aminotransferase class-V 4.7E-07 133 224

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13326|CYSD_SCHPO O-acetylhomoserine (thiol)-lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC428.11 PE=2 SV=1 1 434 0.0E+00
sp|P50125|CYSD_EMENI O-acetylhomoserine (thiol)-lyase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cysD PE=2 SV=2 6 433 0.0E+00
sp|Q92441|MET17_KLULA Protein MET17 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MET17 PE=3 SV=3 7 431 2.0E-177
sp|P06106|MET17_YEAST Protein MET17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET17 PE=1 SV=3 7 439 2.0E-164
sp|P13254|MEGL_PSEPU Methionine gamma-lyase OS=Pseudomonas putida GN=mdeA PE=1 SV=2 2 435 2.0E-71
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13326|CYSD_SCHPO O-acetylhomoserine (thiol)-lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC428.11 PE=2 SV=1 1 434 0.0E+00
sp|P50125|CYSD_EMENI O-acetylhomoserine (thiol)-lyase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cysD PE=2 SV=2 6 433 0.0E+00
sp|Q92441|MET17_KLULA Protein MET17 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MET17 PE=3 SV=3 7 431 2.0E-177
sp|P06106|MET17_YEAST Protein MET17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET17 PE=1 SV=3 7 439 2.0E-164
sp|P13254|MEGL_PSEPU Methionine gamma-lyase OS=Pseudomonas putida GN=mdeA PE=1 SV=2 2 435 2.0E-71
sp|Q83A83|METC_COXBU Cystathionine beta-lyase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=metC PE=1 SV=1 7 431 1.0E-64
sp|P55218|METZ_PSEAE O-succinylhomoserine sulfhydrylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=metZ PE=1 SV=1 63 433 5.0E-64
sp|Q55DV9|CGL_DICDI Cystathionine gamma-lyase OS=Dictyostelium discoideum GN=cysA PE=1 SV=1 13 431 1.0E-63
sp|O05394|MCCB_BACSU Cystathionine gamma-lyase OS=Bacillus subtilis (strain 168) GN=mccB PE=1 SV=1 9 432 2.0E-62
sp|Q8VCN5|CGL_MOUSE Cystathionine gamma-lyase OS=Mus musculus GN=Cth PE=1 SV=1 6 434 1.0E-61
sp|Q60HG7|CGL_MACFA Cystathionine gamma-lyase OS=Macaca fascicularis GN=CTH PE=2 SV=1 4 434 5.0E-60
sp|Q1M0P5|METB_HELPX Cystathionine gamma-synthase OS=Helicobacter pylori GN=metB PE=1 SV=1 7 435 3.0E-59
sp|Q19QT7|CGL_PIG Cystathionine gamma-lyase OS=Sus scrofa GN=CTH PE=2 SV=1 4 437 8.0E-59
sp|P18757|CGL_RAT Cystathionine gamma-lyase OS=Rattus norvegicus GN=Cth PE=1 SV=2 6 434 8.0E-59
sp|P56069|METB_HELPY Cystathionine gamma-synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=metB PE=1 SV=1 8 431 1.0E-58
sp|P9WGB5|METZ_MYCTU O-succinylhomoserine sulfhydrylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=metZ PE=1 SV=1 67 431 4.0E-57
sp|P9WGB4|METZ_MYCTO O-succinylhomoserine sulfhydrylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=metZ PE=3 SV=1 67 431 4.0E-57
sp|P9WGB7|METB_MYCTU Cystathionine gamma-synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=metB PE=1 SV=1 10 431 2.0E-56
sp|P9WGB6|METB_MYCTO Cystathionine gamma-synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=metB PE=3 SV=1 10 431 2.0E-56
sp|P66876|METB_MYCBO Cystathionine gamma-synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=metB PE=3 SV=1 10 431 2.0E-56
sp|A2RM21|METC_LACLM Cystathionine beta-lyase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=metC PE=1 SV=1 5 432 2.0E-56
sp|P0A4K2|METC_LACLA Cystathionine beta-lyase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=metC PE=3 SV=1 5 432 2.0E-56
sp|Q58DW2|CGL_BOVIN Cystathionine gamma-lyase OS=Bos taurus GN=CTH PE=2 SV=1 4 416 1.0E-54
sp|Q9ZMW7|METB_HELPJ Cystathionine gamma-synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=metB PE=3 SV=1 8 435 3.0E-54
sp|P53780|METC_ARATH Cystathionine beta-lyase, chloroplastic OS=Arabidopsis thaliana GN=At3g57050 PE=1 SV=1 24 432 7.0E-54
sp|P46807|METB_MYCLE Cystathionine gamma-synthase OS=Mycobacterium leprae (strain TN) GN=metB PE=3 SV=1 5 432 7.0E-54
sp|P24601|METB_HERAU Probable cystathionine gamma-synthase (Fragment) OS=Herpetosiphon aurantiacus GN=metB PE=3 SV=1 8 371 2.0E-52
sp|P0C2T9|METC_LACLC Cystathionine beta-lyase OS=Lactococcus lactis subsp. cremoris GN=metC PE=1 SV=1 5 432 4.0E-52
sp|P55216|CGL2_CAEEL Putative cystathionine gamma-lyase 2 OS=Caenorhabditis elegans GN=cth-2 PE=3 SV=1 7 434 7.0E-52
sp|P32929|CGL_HUMAN Cystathionine gamma-lyase OS=Homo sapiens GN=CTH PE=1 SV=3 4 434 2.0E-51
sp|P55217|CGS1_ARATH Cystathionine gamma-synthase 1, chloroplastic OS=Arabidopsis thaliana GN=CGS1 PE=1 SV=3 67 433 9.0E-51
sp|O31632|METC_BACSU Cystathionine beta-lyase MetC OS=Bacillus subtilis (strain 168) GN=metC PE=1 SV=1 63 432 1.0E-50
sp|P31373|CYS3_YEAST Cystathionine gamma-lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYS3 PE=1 SV=2 3 435 8.0E-50
sp|P00935|METB_ECOLI Cystathionine gamma-synthase OS=Escherichia coli (strain K12) GN=metB PE=1 SV=1 63 435 7.0E-49
sp|O31631|METI_BACSU Cystathionine gamma-synthase/O-acetylhomoserine (thiol)-lyase OS=Bacillus subtilis (strain 168) GN=metI PE=1 SV=1 6 431 6.0E-47
sp|P44502|METB_HAEIN Cystathionine gamma-synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metB PE=3 SV=1 64 431 1.0E-42
sp|Q9C876|CGS2_ARATH Probable cystathionine gamma-synthase 2 OS=Arabidopsis thaliana GN=CGS2 PE=3 SV=1 63 432 8.0E-40
sp|Q52811|METC_RHIL3 Putative cystathionine beta-lyase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=metC PE=3 SV=2 67 437 7.0E-39
sp|Q9SGU9|MGL_ARATH Methionine gamma-lyase OS=Arabidopsis thaliana GN=MGL PE=1 SV=1 63 431 9.0E-38
sp|O94350|CBL_SCHPO Cystathionine beta-lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str3 PE=3 SV=4 27 435 5.0E-37
sp|Q1K8G0|CBL_NEUCR Cystathionine beta-lyase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=met-2 PE=1 SV=1 64 438 4.0E-33
sp|P44527|METC_HAEIN Cystathionine beta-lyase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metC PE=3 SV=1 44 432 4.0E-25
sp|Q07703|METC_BORAV Cystathionine beta-lyase OS=Bordetella avium GN=metC PE=1 SV=3 6 435 6.0E-25
sp|Q59829|CYSA_STRCO Putative cystathionine gamma-lyase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cysA PE=3 SV=2 64 431 1.0E-21
sp|P43623|METC_YEAST Putative cystathionine beta-lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC7 PE=1 SV=1 16 372 2.0E-20
sp|P06721|METC_ECOLI Cystathionine beta-lyase MetC OS=Escherichia coli (strain K12) GN=metC PE=1 SV=1 73 431 2.0E-19
sp|P18949|METC_SALTY Cystathionine beta-lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metC PE=3 SV=2 73 431 7.0E-19
sp|P53101|STR3_YEAST Cystathionine beta-lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STR3 PE=1 SV=1 63 427 3.0E-18
sp|P38716|YHR2_YEAST Uncharacterized trans-sulfuration enzyme YHR112C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHR112C PE=1 SV=1 157 432 4.0E-11
sp|Q12198|METW_YEAST Putative cystathionine gamma-synthase YLL058W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLL058W PE=1 SV=1 110 445 2.0E-09
sp|A4WAM5|ARNB_ENT38 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Enterobacter sp. (strain 638) GN=arnB PE=3 SV=1 68 198 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0019346 transsulfuration Yes
GO:0030170 pyridoxal phosphate binding Yes
GO:0043436 oxoacid metabolic process No
GO:0008150 biological_process No
GO:0006520 cellular amino acid metabolic process No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0006790 sulfur compound metabolic process No
GO:0043167 ion binding No
GO:0006082 organic acid metabolic process No
GO:0043168 anion binding No
GO:0070279 vitamin B6 binding No
GO:1901605 alpha-amino acid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0009069 serine family amino acid metabolic process No
GO:0008152 metabolic process No
GO:0019842 vitamin binding No
GO:0050667 homocysteine metabolic process No
GO:0009987 cellular process No
GO:0006534 cysteine metabolic process No
GO:0009092 homoserine metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0000096 sulfur amino acid metabolic process No
GO:0097159 organic cyclic compound binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3088
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5506 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5140
Ophiocordyceps camponoti-floridani Ophcf2|01577
Ophiocordyceps camponoti-rufipedis Ophun1|4095
Ophiocordyceps kimflemingae Ophio5|5580
Ophiocordyceps subramaniannii Hirsu2|5370

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5506
MSEQIQNFETLQLHAGAAPDPTTNSRATPIYATTVAQSPTSSPQGRADPLFARATPLMTLPMARGFSPTNDVFEK
RMAALEGGVAALGTSSGQSAQFIAINTLAHAGDNIVSTSNLYGGTYNQFKVFLPRLGIHTKFVQGDRPQDIAAAI
DDSTKAVYVESIGNPRYNVPDLEAIAKVAHEKGVPLVVDNTFGAGGYFIRPIQHGADIVVHSATKWIGGHGTTIG
GVIIDSGKFDWSKHAKRFPQFFEPSEGYHGLKFWDTFGAISFIIRARVEIQRDLGACMNPFAAQQLLLGVETLSL
RAERHAQNSLALAQYLEKSPNVNWVSYPGLESHPYHQAAKKYLKRGFGGVLSFGVKGGGAAGSQVVDGFKLISNL
ANVGDAKTLAIHPWTTTHEQLSDEEKISSGVTEDLIRISVGIEHIDDIIADFEQSFKAASATTKHKEQKHEIQLV
GRAGKTDGAPIAP*
Coding >OphauG2|5506
ATGTCAGAACAAATCCAGAACTTCGAGACGCTGCAGCTTCATGCTGGCGCGGCGCCTGATCCTACAACCAACTCG
CGCGCCACGCCCATCTATGCAACAACGGTAGCGCAGTCTCCCACATCTTCGCCCCAAGGCCGAGCTGACCCCCTG
TTTGCCAGAGCTACACCTTTAATGACTCTGCCCATGGCGCGAGGCTTTTCGCCTACCAACGATGTATTTGAGAAG
CGCATGGCAGCACTCGAGGGCGGCGTCGCAGCGCTGGGCACTTCGTCGGGCCAGAGCGCCCAGTTCATTGCCATC
AACACGCTTGCCCACGCCGGCGACAACATTGTGTCCACGTCCAACCTCTACGGCGGCACTTACAACCAATTCAAG
GTCTTCCTGCCCCGTCTCGGCATCCACACCAAATTTGTCCAGGGAGACCGCCCACAGGACATTGCCGCCGCCATT
GATGACAGCACAAAAGCTGTCTATGTCGAAAGCATTGGCAATCCGCGGTACAACGTCCCAGACCTCGAGGCCATT
GCCAAGGTTGCCCACGAAAAGGGTGTTCCCCTCGTCGTCGACAATACGTTTGGGGCGGGCGGATACTTCATCCGC
CCCATCCAGCATGGTGCCGATATTGTTGTCCACTCAGCCACCAAGTGGATTGGCGGCCACGGCACCACCATTGGA
GGTGTCATCATTGATTCGGGCAAGTTTGACTGGAGCAAGCATGCCAAGCGCTTTCCGCAGTTTTTCGAGCCGTCT
GAAGGCTACCACGGCCTCAAGTTCTGGGATACCTTTGGTGCCATTTCCTTTATAATCCGCGCGCGAGTCGAGATC
CAACGCGATTTGGGAGCCTGCATGAATCCCTTTGCGGCCCAGCAGCTCCTGCTGGGAGTTGAGACCCTCAGCCTG
CGCGCCGAACGCCATGCCCAAAATTCTCTGGCGCTGGCGCAATACCTGGAAAAGAGCCCCAATGTGAACTGGGTC
TCGTACCCCGGTCTGGAGAGCCACCCGTACCACCAAGCAGCCAAAAAGTACCTCAAGCGCGGCTTTGGCGGCGTG
CTGAGCTTTGGCGTCAAGGGCGGCGGCGCTGCTGGGAGTCAGGTGGTCGATGGCTTTAAACTCATTTCCAATCTG
GCCAATGTCGGTGATGCAAAGACGCTCGCCATCCATCCCTGGACCACGACGCATGAACAACTGTCCGACGAGGAA
AAAATCAGCTCTGGTGTCACAGAGGATTTGATTCGCATCTCGGTAGGCATTGAACACATTGACGACATCATTGCC
GATTTCGAACAGTCATTCAAGGCTGCCTCGGCCACGACAAAGCACAAGGAGCAGAAGCATGAGATTCAGCTTGTG
GGAAGAGCGGGTAAGACGGATGGCGCGCCTATTGCGCCATAG
Transcript >OphauG2|5506
ATGTCAGAACAAATCCAGAACTTCGAGACGCTGCAGCTTCATGCTGGCGCGGCGCCTGATCCTACAACCAACTCG
CGCGCCACGCCCATCTATGCAACAACGGTAGCGCAGTCTCCCACATCTTCGCCCCAAGGCCGAGCTGACCCCCTG
TTTGCCAGAGCTACACCTTTAATGACTCTGCCCATGGCGCGAGGCTTTTCGCCTACCAACGATGTATTTGAGAAG
CGCATGGCAGCACTCGAGGGCGGCGTCGCAGCGCTGGGCACTTCGTCGGGCCAGAGCGCCCAGTTCATTGCCATC
AACACGCTTGCCCACGCCGGCGACAACATTGTGTCCACGTCCAACCTCTACGGCGGCACTTACAACCAATTCAAG
GTCTTCCTGCCCCGTCTCGGCATCCACACCAAATTTGTCCAGGGAGACCGCCCACAGGACATTGCCGCCGCCATT
GATGACAGCACAAAAGCTGTCTATGTCGAAAGCATTGGCAATCCGCGGTACAACGTCCCAGACCTCGAGGCCATT
GCCAAGGTTGCCCACGAAAAGGGTGTTCCCCTCGTCGTCGACAATACGTTTGGGGCGGGCGGATACTTCATCCGC
CCCATCCAGCATGGTGCCGATATTGTTGTCCACTCAGCCACCAAGTGGATTGGCGGCCACGGCACCACCATTGGA
GGTGTCATCATTGATTCGGGCAAGTTTGACTGGAGCAAGCATGCCAAGCGCTTTCCGCAGTTTTTCGAGCCGTCT
GAAGGCTACCACGGCCTCAAGTTCTGGGATACCTTTGGTGCCATTTCCTTTATAATCCGCGCGCGAGTCGAGATC
CAACGCGATTTGGGAGCCTGCATGAATCCCTTTGCGGCCCAGCAGCTCCTGCTGGGAGTTGAGACCCTCAGCCTG
CGCGCCGAACGCCATGCCCAAAATTCTCTGGCGCTGGCGCAATACCTGGAAAAGAGCCCCAATGTGAACTGGGTC
TCGTACCCCGGTCTGGAGAGCCACCCGTACCACCAAGCAGCCAAAAAGTACCTCAAGCGCGGCTTTGGCGGCGTG
CTGAGCTTTGGCGTCAAGGGCGGCGGCGCTGCTGGGAGTCAGGTGGTCGATGGCTTTAAACTCATTTCCAATCTG
GCCAATGTCGGTGATGCAAAGACGCTCGCCATCCATCCCTGGACCACGACGCATGAACAACTGTCCGACGAGGAA
AAAATCAGCTCTGGTGTCACAGAGGATTTGATTCGCATCTCGGTAGGCATTGAACACATTGACGACATCATTGCC
GATTTCGAACAGTCATTCAAGGCTGCCTCGGCCACGACAAAGCACAAGGAGCAGAAGCATGAGATTCAGCTTGTG
GGAAGAGCGGGTAAGACGGATGGCGCGCCTATTGCGCCATAG
Gene >OphauG2|5506
ATGTCAGAACAAATCCAGAACTTCGAGACGCTGCAGCTTCATGCTGGGTAAGTCGTCGCCTAGCTCCAAGATGAG
GCACCACTATTGACAATACTTGATGCAAAAGCGCGGCGCCTGATCCTACAACCAACTCGCGCGCCACGCCCATCT
ATGCAACAACGGTAGCGCAGTCTCCCACATCTTCGCCCCAAGGCCGAGCTGACCCCCTGTTTGCCAGAGCTACAC
CTTTAATGACTCTGCCCATGGCGCGAGGCTTTTCGGTCTCAAAGAGTTTGGCAACATATATAGCCGTCTCATGAA
CGCAAGCTGCCCTCTCTGCCCTCTCTGCCCCAGCCACTGGGACCCATGTGCTGACCAAATTCATGGATAGCCTAC
CAACGATGTATTTGAGAAGCGCATGGCAGCACTCGAGGGCGGCGTCGCAGCGCTGGGCACTTCGTCGGGCCAGAG
CGCCCAGTTCATTGCCATCAACACGCTTGCCCACGCCGGCGACAACATTGTGTCCACGTCCAACCTCTACGGCGG
CACTTACAACCAATTCAAGGTCTTCCTGCCCCGTCTCGGCATCCACACCAAATTTGTCCAGGGAGACCGCCCACA
GGACATTGCCGCCGCCATTGATGACAGCACAAAAGCTGTCTATGTCGAAAGCATTGGCAATCCGCGGTACAACGT
CCCAGACCTCGAGGCCATTGCCAAGGTTGCCCACGAAAAGGGTGTTCCCCTCGTCGTCGACAATACGTTTGGGGC
GGGCGGATACTTCATCCGCCCCATCCAGCATGGTGCCGATATTGTTGTCCACTCAGCCACCAAGTGGATTGGCGG
CCACGGCACCACCATTGGAGGTGTCATCATTGATTCGGGCAAGTTTGACTGGAGCAAGCATGCCAAGCGCTTTCC
GCAGTTTTTCGAGCCGTCTGAAGGCTACCACGGCCTCAAGTTCTGGGATACCTTTGGTGCCATTTCCTTTATAAT
CCGCGCGCGAGTCGAGATCCAACGCGATTTGGGAGCCTGCATGAATCCCTTTGCGGCCCAGCAGCTCCTGCTGGG
AGTTGAGACCCTCAGCCTGCGCGCCGAACGCCATGCCCAAAATTCTCTGGCGCTGGCGCAATACCTGGAAAAGAG
CCCCAATGTGAACTGGGTCTCGTACCCCGGTCTGGAGAGCCACCCGTACCACCAAGCAGCCAAAAAGTACCTCAA
GCGCGGCTTTGGCGGCGTGCTGAGCTTTGGCGTCAAGGGCGGCGGCGCTGCTGGGAGTCAGGTGGTCGATGGCTT
TAAACTCATTTCCAATCTGGCCAATGTCGGTGATGCAAAGACGCTCGCCATCCAGTAAGTCAGCCAGCAATAACT
AGTGGGTTCGGTGTGGTAGGCGTATTGTATTGACCATGAATCAGTCCCTGGACCACGACGCATGAACAACTGTCC
GACGAGGAAAAAATCAGCTCTGGTGTCACAGAGGTTGGCGCATAGTATCCGTGCTTGCTGCGACTTGTCGGCTGA
CTGATTCAGGATTTGATTCGCATCTCGGTAGGCATTGAACACATTGACGACATCATTGCCGATTTCGAACAGTCA
TTCAAGGCTGCCTCGGCCACGACAAAGCACAAGGAGCAGAAGCATGAGATTCAGCTTGTGGGAAGAGCGGGTAAG
ACGGATGGCGCGCCTATTGCGCCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail