Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|550
Gene name
LocationContig_113:9528..11992
Strand-
Gene length (bp)2464
Transcript length (bp)2367
Coding sequence length (bp)2367
Protein length (aa) 789

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 2.0E-45 378 589
PF08938 HBS1_N HBS1 N-terminus 3.2E-21 11 80
PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain 2.4E-09 721 786
PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2 5.6E-08 621 687
PF01926 MMR_HSR1 50S ribosome-binding GTPase 1.6E-05 381 504

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5R6Y0|HBS1L_PONAB HBS1-like protein OS=Pongo abelii GN=HBS1L PE=2 SV=1 364 787 3.0E-109
sp|Q9Y450|HBS1L_HUMAN HBS1-like protein OS=Homo sapiens GN=HBS1L PE=1 SV=1 364 787 5.0E-109
sp|Q69ZS7|HBS1L_MOUSE HBS1-like protein OS=Mus musculus GN=Hbs1l PE=1 SV=2 364 787 2.0E-104
sp|Q6AXM7|HBS1L_RAT HBS1-like protein OS=Rattus norvegicus GN=Hbs1l PE=1 SV=1 301 787 2.0E-104
sp|Q2KHZ2|HBS1L_BOVIN HBS1-like protein OS=Bos taurus GN=HBS1L PE=2 SV=1 364 787 4.0E-103
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5R6Y0|HBS1L_PONAB HBS1-like protein OS=Pongo abelii GN=HBS1L PE=2 SV=1 364 787 3.0E-109
sp|Q9Y450|HBS1L_HUMAN HBS1-like protein OS=Homo sapiens GN=HBS1L PE=1 SV=1 364 787 5.0E-109
sp|Q69ZS7|HBS1L_MOUSE HBS1-like protein OS=Mus musculus GN=Hbs1l PE=1 SV=2 364 787 2.0E-104
sp|Q6AXM7|HBS1L_RAT HBS1-like protein OS=Rattus norvegicus GN=Hbs1l PE=1 SV=1 301 787 2.0E-104
sp|Q2KHZ2|HBS1L_BOVIN HBS1-like protein OS=Bos taurus GN=HBS1L PE=2 SV=1 364 787 4.0E-103
sp|O74774|HBS1_SCHPO Elongation factor 1 alpha-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hbs1 PE=1 SV=4 370 788 1.0E-90
sp|A8ABM5|EF1A_IGNH4 Elongation factor 1-alpha OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=tuf PE=3 SV=1 374 787 3.0E-89
sp|Q00251|EF1A_AURPU Elongation factor 1-alpha OS=Aureobasidium pullulans GN=TEF1 PE=3 SV=1 376 788 1.0E-85
sp|P32769|HBS1_YEAST Elongation factor 1 alpha-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HBS1 PE=1 SV=2 380 785 1.0E-85
sp|A1RXW9|EF1A_THEPD Elongation factor 1-alpha OS=Thermofilum pendens (strain Hrk 5) GN=tuf PE=3 SV=1 373 787 2.0E-85
sp|Q59QD6|EF1A2_CANAL Elongation factor 1-alpha 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEF2 PE=3 SV=1 376 788 7.0E-85
sp|P0CY35|EF1A1_CANAL Elongation factor 1-alpha 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEF1 PE=3 SV=1 376 788 8.0E-85
sp|A8MAJ1|EF1A_CALMQ Elongation factor 1-alpha OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=tuf PE=3 SV=1 376 785 1.0E-84
sp|P41745|EF1A_BLAAD Elongation factor 1-alpha OS=Blastobotrys adeninivorans GN=TEF PE=3 SV=1 376 788 2.0E-83
sp|A5DPE3|EF1A_PICGU Elongation factor 1-alpha OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TEF1 PE=3 SV=2 376 788 2.0E-83
sp|Q96WZ1|EF1A_COCIM Elongation factor 1-alpha OS=Coccidioides immitis (strain RS) GN=TEF PE=2 SV=2 376 788 8.0E-83
sp|P90519|EF1A_CRYPV Elongation factor 1-alpha OS=Cryptosporidium parvum PE=2 SV=1 376 788 2.0E-82
sp|Q6L202|EF1A_PICTO Elongation factor 1-alpha OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=tuf PE=3 SV=1 373 785 3.0E-82
sp|P0CT55|EF1A3_SCHPO Elongation factor 1-alpha-B/C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef103 PE=1 SV=1 376 758 5.0E-82
sp|P0CT54|EF1A2_SCHPO Elongation factor 1-alpha-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef102 PE=1 SV=1 376 758 5.0E-82
sp|P31018|EF1A_ENTHI Elongation factor 1-alpha OS=Entamoeba histolytica PE=2 SV=1 376 788 6.0E-82
sp|A3DMQ1|EF1A_STAMF Elongation factor 1-alpha OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=tuf PE=3 SV=1 373 787 7.0E-82
sp|P0CT53|EF1A1_SCHPO Elongation factor 1-alpha-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef101 PE=1 SV=1 376 758 1.0E-81
sp|P40911|EF1A_AJECG Elongation factor 1-alpha OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=TEF PE=2 SV=1 376 788 2.0E-81
sp|P41203|EF1A_DESMO Elongation factor 1-alpha OS=Desulfurococcus mobilis GN=tuf PE=3 SV=1 380 785 2.0E-81
sp|Q01765|EF1A_PODCU Elongation factor 1-alpha OS=Podospora curvicolla GN=TEF PE=3 SV=1 376 788 4.0E-81
sp|A1RRJ3|EF1A_PYRIL Elongation factor 1-alpha OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=tuf PE=3 SV=1 376 785 5.0E-81
sp|Q00080|EF1A_PLAFK Elongation factor 1-alpha OS=Plasmodium falciparum (isolate K1 / Thailand) GN=MEF-1 PE=3 SV=1 376 787 6.0E-81
sp|Q01372|EF1A_NEUCR Elongation factor 1-alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tef-1 PE=3 SV=2 376 788 6.0E-81
sp|Q01520|EF1A_PODAS Elongation factor 1-alpha OS=Podospora anserina GN=TEF PE=3 SV=1 376 788 7.0E-81
sp|P14864|EF1A2_MUCCL Elongation factor 1-alpha OS=Mucor circinelloides f. lusitanicus GN=TEF-2 PE=3 SV=1 376 788 9.0E-81
sp|O93729|EF1A_PYRAE Elongation factor 1-alpha OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=tuf PE=3 SV=1 376 785 2.0E-80
sp|Q18EY5|EF1A_HALWD Elongation factor 1-alpha OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=tuf PE=3 SV=1 376 785 2.0E-80
sp|P0CN30|EF1A_CRYNJ Elongation factor 1-alpha OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TEF1 PE=3 SV=1 376 788 3.0E-80
sp|P0CN31|EF1A_CRYNB Elongation factor 1-alpha OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TEF1 PE=2 SV=1 376 788 3.0E-80
sp|Q09069|EF1A_SORMA Elongation factor 1-alpha OS=Sordaria macrospora GN=TEF PE=3 SV=1 376 788 3.0E-80
sp|Q8TRC4|EF1A_METAC Elongation factor 1-alpha OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=tuf PE=3 SV=1 376 787 3.0E-80
sp|P34825|EF1A_HYPJE Elongation factor 1-alpha OS=Hypocrea jecorina GN=tef1 PE=3 SV=1 376 788 3.0E-80
sp|P41752|EF1A_ASHGO Elongation factor 1-alpha OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TEF PE=3 SV=1 376 788 3.0E-80
sp|A0RUM4|EF1A_CENSY Elongation factor 1-alpha OS=Cenarchaeum symbiosum (strain A) GN=tuf PE=3 SV=1 380 788 3.0E-80
sp|P06805|EF1A1_MUCCL Elongation factor 1-alpha OS=Mucor circinelloides f. lusitanicus GN=TEF-1 PE=3 SV=1 376 788 4.0E-80
sp|P14963|EF1A_EUGGR Elongation factor 1-alpha OS=Euglena gracilis GN=TEF PE=2 SV=1 376 760 5.0E-80
sp|Q3IUD8|EF1A_NATPD Elongation factor 1-alpha OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=tuf PE=3 SV=1 373 785 1.0E-79
sp|A3MV69|EF1A_PYRCJ Elongation factor 1-alpha OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=tuf PE=3 SV=1 376 785 2.0E-79
sp|Q9Y713|EF1A_ASPOR Elongation factor 1-alpha OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tef1 PE=3 SV=1 376 788 3.0E-79
sp|O59949|EF1A_YARLI Elongation factor 1-alpha OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TEF PE=2 SV=2 376 788 3.0E-79
sp|P14865|EF1A3_MUCCL Elongation factor 1-alpha OS=Mucor circinelloides f. lusitanicus GN=TEF-3 PE=3 SV=1 376 788 5.0E-79
sp|P19486|EF1A_THEAC Elongation factor 1-alpha OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=tuf PE=3 SV=2 373 785 6.0E-79
sp|P16018|EF1A_HALMA Elongation factor 1-alpha OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=tuf PE=1 SV=2 374 785 6.0E-79
sp|P28295|EF1A_ABSGL Elongation factor 1-alpha OS=Absidia glauca GN=TEF-1 PE=3 SV=1 376 788 6.0E-79
sp|P35021|EF1A_SULSO Elongation factor 1-alpha OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=tuf PE=1 SV=3 374 787 6.0E-79
sp|P02994|EF1A_YEAST Elongation factor 1-alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TEF1 PE=1 SV=1 376 788 8.0E-79
sp|P50256|EF1AC_PORPU Elongation factor 1-alpha C OS=Porphyra purpurea GN=TEF-C PE=2 SV=1 376 788 1.0E-78
sp|B8GIQ3|EF1A_METPE Elongation factor 1-alpha OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=tuf PE=3 SV=1 373 787 2.0E-78
sp|A4WKK8|EF1A_PYRAR Elongation factor 1-alpha OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=tuf PE=3 SV=1 376 785 2.0E-78
sp|A4YCR6|EF1A_METS5 Elongation factor 1-alpha OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=tuf PE=3 SV=1 380 787 3.0E-78
sp|Q9YAV0|EF1A_AERPE Elongation factor 1-alpha OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=tuf PE=1 SV=1 376 787 4.0E-78
sp|O29325|EF1A_ARCFU Elongation factor 1-alpha OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=tuf PE=3 SV=1 373 787 6.0E-78
sp|A2BN41|EF1A_HYPBU Elongation factor 1-alpha OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=tuf PE=3 SV=1 373 787 7.0E-78
sp|P0CT32|EF1A2_DICDI Elongation factor 1-alpha OS=Dictyostelium discoideum GN=eef1a2 PE=1 SV=1 376 788 9.0E-78
sp|P0CT31|EF1A1_DICDI Elongation factor 1-alpha OS=Dictyostelium discoideum GN=eef1a1 PE=1 SV=1 376 788 9.0E-78
sp|P86939|EF1A2_TRYB2 Elongation factor 1-alpha 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb10.70.5670 PE=1 SV=1 376 788 9.0E-78
sp|P86934|EF1A1_TRYB2 Elongation factor 1-alpha 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=TEF1 PE=1 SV=1 376 788 9.0E-78
sp|Q8LPC4|EF1A_PYRYE Elongation factor 1-alpha OS=Pyropia yezoensis PE=2 SV=1 376 788 1.0E-77
sp|P32186|EF1A_PUCGR Elongation factor 1-alpha OS=Puccinia graminis GN=TEF PE=3 SV=2 376 752 2.0E-77
sp|P19039|EF1A_APIME Elongation factor 1-alpha OS=Apis mellifera PE=3 SV=1 376 788 3.0E-77
sp|Q9HM89|EF1A_HALSA Elongation factor 1-alpha OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tuf PE=3 SV=1 376 785 3.0E-77
sp|B0R8C3|EF1A_HALS3 Elongation factor 1-alpha OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=tuf PE=3 SV=1 376 785 3.0E-77
sp|Q04634|EF1A_TETPY Elongation factor 1-alpha OS=Tetrahymena pyriformis PE=2 SV=1 376 788 5.0E-77
sp|Q0W8G2|EF1A_METAR Elongation factor 1-alpha OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=tuf PE=3 SV=1 375 787 5.0E-77
sp|Q5R4B3|ERF3B_PONAB Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Pongo abelii GN=GSPT2 PE=2 SV=1 376 785 8.0E-77
sp|Q27139|EF1A1_EUPCR Elongation factor 1-alpha 1 OS=Euplotes crassus GN=EFA1 PE=3 SV=1 376 788 9.0E-77
sp|A2STF0|EF1A_METLZ Elongation factor 1-alpha OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=tuf PE=3 SV=1 375 787 9.0E-77
sp|Q8IYD1|ERF3B_HUMAN Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Homo sapiens GN=GSPT2 PE=1 SV=2 376 785 1.0E-76
sp|Q979T1|EF1A_THEVO Elongation factor 1-alpha OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=tuf PE=3 SV=2 373 785 1.0E-76
sp|Q149F3|ERF3B_MOUSE Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Mus musculus GN=Gspt2 PE=1 SV=1 376 785 2.0E-76
sp|C6A4R7|EF1A_THESM Elongation factor 1-alpha OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=tuf PE=3 SV=1 373 787 3.0E-76
sp|Q9HDF6|EF1A_PIRIN Elongation factor 1-alpha OS=Piriformospora indica GN=TEF1 PE=2 SV=1 376 788 3.0E-76
sp|O42820|EF1A_SCHCO Elongation factor 1-alpha OS=Schizophyllum commune GN=TEF1 PE=3 SV=1 376 788 4.0E-76
sp|P86933|EF1A_TRYBB Elongation factor 1-alpha OS=Trypanosoma brucei brucei GN=TEF1 PE=2 SV=1 376 788 4.0E-76
sp|P54959|EF1A_BLAHO Elongation factor 1-alpha OS=Blastocystis hominis PE=2 SV=1 376 788 8.0E-76
sp|P15170|ERF3A_HUMAN Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens GN=GSPT1 PE=1 SV=1 376 785 1.0E-75
sp|P53013|EF1A_CAEEL Elongation factor 1-alpha OS=Caenorhabditis elegans GN=eft-3 PE=3 SV=1 376 788 3.0E-75
sp|Q57770|EF1A_METJA Elongation factor 1-alpha OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=tuf PE=3 SV=1 384 786 3.0E-75
sp|A7I656|EF1A_METB6 Elongation factor 1-alpha OS=Methanoregula boonei (strain 6A8) GN=tuf PE=3 SV=1 376 787 4.0E-75
sp|P17196|EF1A_SULAC Elongation factor 1-alpha OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=tuf PE=3 SV=1 380 787 4.0E-75
sp|Q8R050|ERF3A_MOUSE Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Mus musculus GN=Gspt1 PE=1 SV=2 376 785 5.0E-75
sp|P34823|EF1A2_DAUCA Elongation factor 1-alpha OS=Daucus carota PE=2 SV=1 380 788 5.0E-75
sp|P25166|EF1A_STYLE Elongation factor 1-alpha OS=Stylonychia lemnae GN=EFAA PE=3 SV=1 376 788 8.0E-75
sp|Q9YIC0|EF1A_ORYLA Elongation factor 1-alpha OS=Oryzias latipes GN=eef1a PE=2 SV=1 376 788 2.0E-74
sp|P02993|EF1A_ARTSA Elongation factor 1-alpha OS=Artemia salina PE=1 SV=2 376 788 2.0E-74
sp|Q2HJN8|EF1A2_OSCTI Elongation factor 1-alpha 2 OS=Oscheius tipulae GN=eft-2 PE=3 SV=1 376 788 4.0E-74
sp|Q8PUR8|EF1A_METMA Elongation factor 1-alpha OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=tuf PE=3 SV=1 376 787 4.0E-74
sp|A2Q0Z0|EF1A1_HORSE Elongation factor 1-alpha 1 OS=Equus caballus GN=EEF1A1 PE=2 SV=1 376 788 6.0E-74
sp|P08736|EF1A1_DROME Elongation factor 1-alpha 1 OS=Drosophila melanogaster GN=Ef1alpha48D PE=1 SV=2 376 788 7.0E-74
sp|Q2HJN6|EF1A3_OSCTI Elongation factor 1-alpha 3 OS=Oscheius tipulae GN=eft-3 PE=3 SV=1 376 788 9.0E-74
sp|P29521|EF1A1_DAUCA Elongation factor 1-alpha OS=Daucus carota PE=1 SV=1 376 788 9.0E-74
sp|Q464Z4|EF1A_METBF Elongation factor 1-alpha OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=tuf PE=3 SV=1 376 787 1.0E-73
sp|O64937|EF1A_ORYSJ Elongation factor 1-alpha OS=Oryza sativa subsp. japonica GN=REFA1 PE=2 SV=2 376 788 1.0E-73
sp|P17786|EF1A_SOLLC Elongation factor 1-alpha OS=Solanum lycopersicum PE=2 SV=1 380 788 2.0E-73
sp|Q2HJN9|EF1A4_OSCTI Elongation factor 1-alpha 4 OS=Oscheius tipulae GN=eft-4 PE=3 SV=1 376 788 2.0E-73
sp|Q8GTY0|EF1A4_ARATH Elongation factor 1-alpha 4 OS=Arabidopsis thaliana GN=A4 PE=1 SV=2 376 788 2.0E-73
sp|Q0WL56|EF1A3_ARATH Elongation factor 1-alpha 3 OS=Arabidopsis thaliana GN=A3 PE=1 SV=2 376 788 2.0E-73
sp|Q8W4H7|EF1A2_ARATH Elongation factor 1-alpha 2 OS=Arabidopsis thaliana GN=A2 PE=1 SV=2 376 788 2.0E-73
sp|P0DH99|EF1A1_ARATH Elongation factor 1-alpha 1 OS=Arabidopsis thaliana GN=A1 PE=1 SV=1 376 788 2.0E-73
sp|Q03033|EF1A_WHEAT Elongation factor 1-alpha OS=Triticum aestivum GN=TEF1 PE=2 SV=1 376 788 2.0E-73
sp|P62630|EF1A1_RAT Elongation factor 1-alpha 1 OS=Rattus norvegicus GN=Eef1a1 PE=2 SV=1 376 788 2.0E-73
sp|P10126|EF1A1_MOUSE Elongation factor 1-alpha 1 OS=Mus musculus GN=Eef1a1 PE=1 SV=3 376 788 2.0E-73
sp|P62629|EF1A1_CRIGR Elongation factor 1-alpha 1 OS=Cricetulus griseus GN=EEF1A1 PE=2 SV=1 376 788 2.0E-73
sp|P43643|EF1A_TOBAC Elongation factor 1-alpha OS=Nicotiana tabacum PE=2 SV=1 376 788 3.0E-73
sp|A0B7D6|EF1A_METTP Elongation factor 1-alpha OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=tuf PE=3 SV=1 373 788 3.0E-73
sp|Q41803|EF1A_MAIZE Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3 SV=1 376 788 4.0E-73
sp|P27592|EF1A_ONCVO Elongation factor 1-alpha OS=Onchocerca volvulus PE=2 SV=1 376 788 4.0E-73
sp|P68105|EF1A1_RABIT Elongation factor 1-alpha 1 OS=Oryctolagus cuniculus GN=EEF1A1 PE=1 SV=1 376 788 5.0E-73
sp|Q5R4R8|EF1A1_PONAB Elongation factor 1-alpha 1 OS=Pongo abelii GN=EEF1A1 PE=2 SV=2 376 788 5.0E-73
sp|Q5R1X2|EF1A1_PANTR Elongation factor 1-alpha 1 OS=Pan troglodytes GN=EEF1A1 PE=2 SV=1 376 788 5.0E-73
sp|P68104|EF1A1_HUMAN Elongation factor 1-alpha 1 OS=Homo sapiens GN=EEF1A1 PE=1 SV=1 376 788 5.0E-73
sp|Q66RN5|EF1A1_FELCA Elongation factor 1-alpha 1 OS=Felis catus GN=EEF1A1 PE=2 SV=1 376 788 5.0E-73
sp|P68103|EF1A1_BOVIN Elongation factor 1-alpha 1 OS=Bos taurus GN=EEF1A1 PE=1 SV=1 376 788 5.0E-73
sp|P29520|EF1A_BOMMO Elongation factor 1-alpha OS=Bombyx mori PE=2 SV=1 376 788 5.0E-73
sp|Q2HJN4|EF1A1_OSCTI Elongation factor 1-alpha 1 OS=Oscheius tipulae GN=eft-1 PE=3 SV=1 376 788 6.0E-73
sp|O24534|EF1A_VICFA Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1 376 788 6.0E-73
sp|Q90835|EF1A_CHICK Elongation factor 1-alpha 1 OS=Gallus gallus GN=EEF1A PE=2 SV=1 376 788 7.0E-73
sp|Q5VTE0|EF1A3_HUMAN Putative elongation factor 1-alpha-like 3 OS=Homo sapiens GN=EEF1A1P5 PE=5 SV=1 376 788 1.0E-72
sp|P17197|EF1A_THECE Elongation factor 1-alpha OS=Thermococcus celer GN=tuf PE=3 SV=1 373 787 1.0E-72
sp|P51554|EF1A_HYDVU Elongation factor 1-alpha OS=Hydra vulgaris PE=2 SV=1 376 788 1.0E-72
sp|Q976B1|EF1A_SULTO Elongation factor 1-alpha OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=tuf PE=3 SV=1 380 787 1.0E-72
sp|P13549|EF1A0_XENLA Elongation factor 1-alpha, somatic form OS=Xenopus laevis GN=eef1as PE=2 SV=1 376 788 1.0E-72
sp|P25698|EF1A_SOYBN Elongation factor 1-alpha OS=Glycine max GN=TEFS1 PE=3 SV=2 376 788 2.0E-72
sp|Q40034|EF1A2_HORVU Elongation factor 1-alpha OS=Hordeum vulgare GN=BLT63 PE=1 SV=1 380 788 2.0E-72
sp|Q8U152|EF1A_PYRFU Elongation factor 1-alpha OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=tuf PE=3 SV=1 376 787 3.0E-72
sp|B6YVG2|EF1A_THEON Elongation factor 1-alpha OS=Thermococcus onnurineus (strain NA1) GN=tuf PE=3 SV=1 373 787 3.0E-72
sp|O49169|EF1A_MANES Elongation factor 1-alpha OS=Manihot esculenta GN=EF1 PE=3 SV=1 376 788 3.0E-72
sp|Q12WT3|EF1A_METBU Elongation factor 1-alpha OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=tuf PE=3 SV=1 376 787 3.0E-72
sp|P26751|EF1A_PYRWO Elongation factor 1-alpha OS=Pyrococcus woesei GN=tuf PE=3 SV=1 376 787 4.0E-72
sp|A6VGV6|EF1A_METM7 Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=tuf PE=3 SV=1 384 786 5.0E-72
sp|Q92005|EF1A_DANRE Elongation factor 1-alpha OS=Danio rerio GN=eef1a PE=2 SV=1 376 788 5.0E-72
sp|A9A9U3|EF1A_METM6 Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=tuf PE=3 SV=1 384 786 6.0E-72
sp|Q5JFZ4|EF1A_THEKO Elongation factor 1-alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=tuf PE=3 SV=1 373 787 8.0E-72
sp|P05303|EF1A2_DROME Elongation factor 1-alpha 2 OS=Drosophila melanogaster GN=Ef1alpha100E PE=2 SV=2 376 788 1.0E-71
sp|A4FWE9|EF1A_METM5 Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=tuf PE=3 SV=1 384 786 1.0E-71
sp|A6UQ14|EF1A_METVS Elongation factor 1-alpha OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=tuf PE=3 SV=1 373 786 2.0E-71
sp|Q41011|EF1A_PEA Elongation factor 1-alpha OS=Pisum sativum PE=2 SV=1 376 788 2.0E-71
sp|P34824|EF1A1_HORVU Elongation factor 1-alpha OS=Hordeum vulgare PE=1 SV=1 376 788 2.0E-71
sp|Q8TYP6|EF1A_METKA Elongation factor 1-alpha OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=tuf PE=3 SV=1 373 787 2.0E-71
sp|P07810|EF1A_METVA Elongation factor 1-alpha OS=Methanococcus vannielii GN=tuf PE=3 SV=1 373 786 5.0E-71
sp|C5A5P4|EF1A_THEGJ Elongation factor 1-alpha OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=tuf PE=3 SV=1 373 787 6.0E-71
sp|P84316|EF1A_HELZE Elongation factor 1-alpha (Fragment) OS=Helicoverpa zea PE=3 SV=1 386 767 1.0E-70
sp|P84315|EF1A_HELVI Elongation factor 1-alpha (Fragment) OS=Heliothis virescens PE=3 SV=1 386 767 1.0E-70
sp|P84318|EF1A_HELGL Elongation factor 1-alpha (Fragment) OS=Helicoverpa gelotopoeon PE=3 SV=1 386 767 1.0E-70
sp|P84320|EF1A_HELDI Elongation factor 1-alpha (Fragment) OS=Heliocheilus discalis PE=3 SV=1 386 767 1.0E-70
sp|P84317|EF1A_HELAM Elongation factor 1-alpha (Fragment) OS=Helicoverpa armigera PE=3 SV=1 386 767 1.0E-70
sp|P84319|EF1A_HELAL Elongation factor 1-alpha (Fragment) OS=Heliocheilus albipunctella PE=3 SV=1 386 767 1.0E-70
sp|P84322|EF1A_ANIIF Elongation factor 1-alpha (Fragment) OS=Anicla infecta PE=3 SV=1 386 767 1.0E-70
sp|P84321|EF1A_ADIBE Elongation factor 1-alpha (Fragment) OS=Adisura bella PE=3 SV=1 386 767 1.0E-70
sp|Q2FRI3|EF1A_METHJ Elongation factor 1-alpha OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=tuf PE=3 SV=1 373 787 2.0E-70
sp|Q26487|EF1A_SPOFR Elongation factor 1-alpha (Fragment) OS=Spodoptera frugiperda PE=1 SV=1 386 767 3.0E-70
sp|O59153|EF1A_PYRHO Elongation factor 1-alpha OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=tuf PE=1 SV=1 376 787 4.0E-70
sp|Q6LXI1|EF1A_METMP Elongation factor 1-alpha OS=Methanococcus maripaludis (strain S2 / LL) GN=tuf PE=3 SV=1 384 786 6.0E-70
sp|P17507|EF1A2_XENLA Elongation factor 1-alpha, oocyte form OS=Xenopus laevis GN=eef1ao PE=1 SV=1 376 788 6.0E-70
sp|Q71V39|EF1A2_RABIT Elongation factor 1-alpha 2 OS=Oryctolagus cuniculus GN=EEF1A2 PE=1 SV=1 376 788 7.0E-70
sp|Q05639|EF1A2_HUMAN Elongation factor 1-alpha 2 OS=Homo sapiens GN=EEF1A2 PE=1 SV=1 376 788 7.0E-70
sp|Q32PH8|EF1A2_BOVIN Elongation factor 1-alpha 2 OS=Bos taurus GN=EEF1A2 PE=2 SV=1 376 788 7.0E-70
sp|P62632|EF1A2_RAT Elongation factor 1-alpha 2 OS=Rattus norvegicus GN=Eef1a2 PE=1 SV=1 376 788 7.0E-70
sp|P62631|EF1A2_MOUSE Elongation factor 1-alpha 2 OS=Mus musculus GN=Eef1a2 PE=1 SV=1 376 788 7.0E-70
sp|Q9V0V7|EF1A_PYRAB Elongation factor 1-alpha OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tuf PE=3 SV=1 376 787 1.0E-69
sp|A3CTG3|EF1A_METMJ Elongation factor 1-alpha OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=tuf PE=3 SV=1 376 787 1.0E-69
sp|P17508|EF1A3_XENLA Elongation factor 1-alpha, oocyte form OS=Xenopus laevis PE=1 SV=2 376 755 1.0E-69
sp|O13354|ERF3_CANAX Eukaryotic peptide chain release factor GTP-binding subunit OS=Candida albicans GN=SUP35 PE=3 SV=1 323 785 6.0E-69
sp|A6UV43|EF1A_META3 Elongation factor 1-alpha OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=tuf PE=3 SV=1 384 786 8.0E-69
sp|P23637|ERF3_OGAPI Eukaryotic peptide chain release factor GTP-binding subunit OS=Ogataea pini GN=SUP2 PE=3 SV=1 376 785 1.0E-68
sp|Q9HGI7|ERF3_CANMA Eukaryotic peptide chain release factor GTP-binding subunit OS=Candida maltosa GN=SUP35 PE=3 SV=2 376 787 1.0E-68
sp|Q9HGI8|ERF3_KLULA Eukaryotic peptide chain release factor GTP-binding subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SUP35 PE=3 SV=1 376 787 2.0E-68
sp|Q9HGI4|ERF3_ZYGRO Eukaryotic peptide chain release factor GTP-binding subunit OS=Zygosaccharomyces rouxii GN=SUP35 PE=3 SV=2 376 785 4.0E-68
sp|Q9HGI6|ERF3_DEBHA Eukaryotic peptide chain release factor GTP-binding subunit OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SUP35 PE=3 SV=4 376 787 6.0E-68
sp|A5ULM5|EF1A_METS3 Elongation factor 1-alpha OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=tuf PE=3 SV=2 373 786 6.0E-68
sp|Q27140|EF1A2_EUPCR Elongation factor 1-alpha 2 OS=Euplotes crassus GN=EFA2 PE=3 SV=1 376 788 1.0E-67
sp|O74718|ERF3_SCHPO Eukaryotic peptide chain release factor GTP-binding subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sup35 PE=1 SV=2 365 785 2.0E-66
sp|P17506|EF1A1_XENLA Elongation factor 1-alpha OS=Xenopus laevis PE=1 SV=2 372 760 4.0E-65
sp|Q74MI6|EF1A_NANEQ Elongation factor 1-alpha OS=Nanoarchaeum equitans (strain Kin4-M) GN=tuf PE=3 SV=1 375 786 1.0E-64
sp|Q08046|EF1A_GIAIN Elongation factor 1-alpha (Fragment) OS=Giardia intestinalis GN=TEF1 PE=2 SV=1 392 767 2.0E-64
sp|P05453|ERF3_YEAST Eukaryotic peptide chain release factor GTP-binding subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUP35 PE=1 SV=1 376 787 8.0E-64
sp|O27132|EF1A_METTH Elongation factor 1-alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=tuf PE=1 SV=1 373 786 3.0E-63
sp|Q2NEL1|EF1A_METST Elongation factor 1-alpha OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=tuf PE=3 SV=1 373 786 3.0E-63
sp|Q7YZN9|ERF3_DICDI Eukaryotic peptide chain release factor GTP-binding subunit OS=Dictyostelium discoideum GN=erf3 PE=2 SV=1 374 785 6.0E-63
sp|P50257|EF1AS_PORPU Elongation factor 1-alpha S OS=Porphyra purpurea GN=TEF-S PE=2 SV=1 376 736 4.0E-62
sp|P27634|EF1A_RHYAM Elongation factor 1-alpha (Fragment) OS=Rhynchosciara americana PE=2 SV=1 424 788 1.0E-57
sp|B3PII1|CYSN_CELJU Sulfate adenylyltransferase subunit 1 OS=Cellvibrio japonicus (strain Ueda107) GN=cysN PE=3 SV=1 365 693 7.0E-54
sp|A8EWR6|CYSN_ARCB4 Sulfate adenylyltransferase subunit 1 OS=Arcobacter butzleri (strain RM4018) GN=cysN PE=3 SV=1 365 692 2.0E-53
sp|Q21IS6|CYSN_SACD2 Sulfate adenylyltransferase subunit 1 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=cysN PE=3 SV=1 365 699 7.0E-53
sp|Q7NVN5|CYSN_CHRVO Sulfate adenylyltransferase subunit 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysN PE=3 SV=1 365 691 3.0E-52
sp|O50274|CYSNC_PSEAE Bifunctional enzyme CysN/CysC OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysNC PE=3 SV=1 365 787 7.0E-52
sp|Q8AAP9|CYSN_BACTN Sulfate adenylyltransferase subunit 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=cysN PE=3 SV=1 364 687 2.0E-51
sp|Q5LES3|CYSN_BACFN Sulfate adenylyltransferase subunit 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=cysN PE=3 SV=1 364 687 2.0E-51
sp|Q64VQ9|CYSN_BACFR Sulfate adenylyltransferase subunit 1 OS=Bacteroides fragilis (strain YCH46) GN=cysN PE=3 SV=1 364 687 3.0E-51
sp|B1Z7C0|CYSN_METPB Sulfate adenylyltransferase subunit 1 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=cysN PE=3 SV=1 358 702 2.0E-50
sp|A9W4X1|CYSN_METEP Sulfate adenylyltransferase subunit 1 OS=Methylobacterium extorquens (strain PA1) GN=cysN PE=3 SV=1 358 702 3.0E-50
sp|B7L0X9|CYSN_METC4 Sulfate adenylyltransferase subunit 1 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=cysN PE=3 SV=1 358 702 7.0E-50
sp|A0KP35|CYSN_AERHH Sulfate adenylyltransferase subunit 1 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=cysN PE=3 SV=1 381 722 2.0E-49
sp|A4IXZ5|CYSN_FRATW Sulfate adenylyltransferase subunit 1 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=cysN PE=3 SV=1 367 686 4.0E-49
sp|B5FGJ9|CYSN_VIBFM Sulfate adenylyltransferase subunit 1 OS=Vibrio fischeri (strain MJ11) GN=cysN PE=3 SV=1 367 699 5.0E-49
sp|Q482Z9|CYSN_COLP3 Sulfate adenylyltransferase subunit 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=cysN PE=3 SV=1 365 687 5.0E-49
sp|Q15VB8|CYSN_PSEA6 Sulfate adenylyltransferase subunit 1 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=cysN PE=3 SV=1 365 713 1.0E-48
sp|Q5E830|CYSN_VIBF1 Sulfate adenylyltransferase subunit 1 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=cysN PE=3 SV=1 367 699 1.0E-48
sp|B4RTW4|CYSN_ALTMD Sulfate adenylyltransferase subunit 1 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=cysN PE=3 SV=1 365 700 1.0E-48
sp|C4LAG3|CYSN_TOLAT Sulfate adenylyltransferase subunit 1 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=cysN PE=3 SV=1 367 687 1.0E-48
sp|A7MJ69|CYSN_CROS8 Sulfate adenylyltransferase subunit 1 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cysN PE=3 SV=1 381 693 2.0E-48
sp|Q8UH69|CYSN_AGRFC Sulfate adenylyltransferase subunit 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysN PE=3 SV=1 377 706 2.0E-48
sp|Q7UMW2|CYSNC_RHOBA Bifunctional enzyme CysN/CysC OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=cysNC PE=3 SV=1 365 677 2.0E-48
sp|Q7MPF2|CYSN_VIBVY Sulfate adenylyltransferase subunit 1 OS=Vibrio vulnificus (strain YJ016) GN=cysN PE=3 SV=1 381 686 3.0E-48
sp|Q5NG10|CYSN_FRATT Sulfate adenylyltransferase subunit 1 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=cysN PE=3 SV=1 367 686 4.0E-48
sp|A0Q6F0|CYSN_FRATN Sulfate adenylyltransferase subunit 1 OS=Francisella tularensis subsp. novicida (strain U112) GN=cysN PE=3 SV=1 367 686 4.0E-48
sp|Q14HG2|CYSN_FRAT1 Sulfate adenylyltransferase subunit 1 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=cysN PE=3 SV=1 367 686 4.0E-48
sp|Q8DE73|CYSN_VIBVU Sulfate adenylyltransferase subunit 1 OS=Vibrio vulnificus (strain CMCP6) GN=cysN PE=3 SV=1 381 686 5.0E-48
sp|P72339|NODQ_RHIS3 Bifunctional enzyme NodQ OS=Rhizobium sp. (strain N33) GN=nodQ PE=3 SV=1 365 713 5.0E-48
sp|A8ANW5|CYSN_CITK8 Sulfate adenylyltransferase subunit 1 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cysN PE=3 SV=1 381 693 9.0E-48
sp|B6ELP3|CYSN_ALISL Sulfate adenylyltransferase subunit 1 OS=Aliivibrio salmonicida (strain LFI1238) GN=cysN PE=3 SV=1 381 699 9.0E-48
sp|C1D890|CYSN_LARHH Sulfate adenylyltransferase subunit 1 OS=Laribacter hongkongensis (strain HLHK9) GN=cysN PE=3 SV=1 365 712 1.0E-47
sp|B1KMH4|CYSN_SHEWM Sulfate adenylyltransferase subunit 1 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=cysN PE=3 SV=1 367 686 1.0E-47
sp|C5BSJ5|CYSN_TERTT Sulfate adenylyltransferase subunit 1 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=cysN PE=3 SV=1 381 693 2.0E-47
sp|A6QB12|CYSN_SULNB Sulfate adenylyltransferase subunit 1 OS=Sulfurovum sp. (strain NBC37-1) GN=cysN PE=3 SV=1 364 691 2.0E-47
sp|A4SRG8|CYSN_AERS4 Sulfate adenylyltransferase subunit 1 OS=Aeromonas salmonicida (strain A449) GN=cysN PE=3 SV=1 381 692 2.0E-47
sp|A7MWE9|CYSN_VIBCB Sulfate adenylyltransferase subunit 1 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cysN PE=3 SV=1 367 686 4.0E-47
sp|A1JJT0|CYSN_YERE8 Sulfate adenylyltransferase subunit 1 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cysN PE=3 SV=1 381 693 4.0E-47
sp|B7VKY2|CYSN_VIBTL Sulfate adenylyltransferase subunit 1 OS=Vibrio tasmaniensis (strain LGP32) GN=cysN PE=3 SV=1 376 702 6.0E-47
sp|B2VG01|CYSN_ERWT9 Sulfate adenylyltransferase subunit 1 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=cysN PE=3 SV=1 381 689 8.0E-47
sp|B7LWK4|CYSN_ESCF3 Sulfate adenylyltransferase subunit 1 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=cysN PE=3 SV=1 381 693 9.0E-47
sp|O33581|CYSN_RHITR Sulfate adenylyltransferase subunit 1 OS=Rhizobium tropici GN=cysN PE=3 SV=2 377 687 1.0E-46
sp|B7UHH0|CYSN_ECO27 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=cysN PE=3 SV=1 381 693 2.0E-46
sp|B2TZI0|CYSN_SHIB3 Sulfate adenylyltransferase subunit 1 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=cysN PE=3 SV=1 381 693 2.0E-46
sp|Q9PD78|CYSNC_XYLFA Bifunctional enzyme CysN/CysC OS=Xylella fastidiosa (strain 9a5c) GN=cysNC PE=3 SV=2 366 713 2.0E-46
sp|C0PXB1|CYSN_SALPC Sulfate adenylyltransferase subunit 1 OS=Salmonella paratyphi C (strain RKS4594) GN=cysN PE=3 SV=1 381 693 3.0E-46
sp|Q57KJ0|CYSN_SALCH Sulfate adenylyltransferase subunit 1 OS=Salmonella choleraesuis (strain SC-B67) GN=cysN PE=3 SV=1 381 693 3.0E-46
sp|B5RDQ7|CYSN_SALG2 Sulfate adenylyltransferase subunit 1 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=cysN PE=3 SV=1 381 693 3.0E-46
sp|B9JB95|CYSN_AGRRK Sulfate adenylyltransferase subunit 1 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=cysN PE=3 SV=1 377 687 5.0E-46
sp|B5QW22|CYSN_SALEP Sulfate adenylyltransferase subunit 1 OS=Salmonella enteritidis PT4 (strain P125109) GN=cysN PE=3 SV=1 381 693 5.0E-46
sp|Q8ZMF5|CYSN_SALTY Sulfate adenylyltransferase subunit 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysN PE=3 SV=1 381 693 6.0E-46
sp|B4TTW5|CYSN_SALSV Sulfate adenylyltransferase subunit 1 OS=Salmonella schwarzengrund (strain CVM19633) GN=cysN PE=3 SV=1 381 693 6.0E-46
sp|B5F415|CYSN_SALA4 Sulfate adenylyltransferase subunit 1 OS=Salmonella agona (strain SL483) GN=cysN PE=3 SV=1 381 693 6.0E-46
sp|B5FTS9|CYSN_SALDC Sulfate adenylyltransferase subunit 1 OS=Salmonella dublin (strain CT_02021853) GN=cysN PE=3 SV=1 381 693 6.0E-46
sp|Q31XB3|CYSN_SHIBS Sulfate adenylyltransferase subunit 1 OS=Shigella boydii serotype 4 (strain Sb227) GN=cysN PE=3 SV=1 381 693 6.0E-46
sp|A9N2D8|CYSN_SALPB Sulfate adenylyltransferase subunit 1 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cysN PE=3 SV=1 381 693 7.0E-46
sp|B4TFX1|CYSN_SALHS Sulfate adenylyltransferase subunit 1 OS=Salmonella heidelberg (strain SL476) GN=cysN PE=3 SV=1 381 693 7.0E-46
sp|B7N6Y1|CYSN_ECOLU Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=cysN PE=3 SV=1 381 693 8.0E-46
sp|Q87SX9|CYSN_VIBPA Sulfate adenylyltransferase subunit 1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cysN PE=3 SV=1 367 687 9.0E-46
sp|C3LRM1|CYSN_VIBCM Sulfate adenylyltransferase subunit 1 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=cysN PE=3 SV=1 381 702 9.0E-46
sp|Q9KP20|CYSN_VIBCH Sulfate adenylyltransferase subunit 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysN PE=3 SV=1 381 702 9.0E-46
sp|A5F578|CYSN_VIBC3 Sulfate adenylyltransferase subunit 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=cysN PE=3 SV=1 381 702 1.0E-45
sp|B7LXG3|CYSN_ECO8A Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O8 (strain IAI1) GN=cysN PE=3 SV=1 381 693 1.0E-45
sp|B7LEG9|CYSN_ECO55 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain 55989 / EAEC) GN=cysN PE=3 SV=1 381 693 1.0E-45
sp|Q1QUF9|CYSN_CHRSD Sulfate adenylyltransferase subunit 1 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=cysN PE=3 SV=1 365 693 1.0E-45
sp|Q87DG7|CYSNC_XYLFT Bifunctional enzyme CysN/CysC OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysNC PE=3 SV=1 366 713 1.0E-45
sp|A8A3N0|CYSN_ECOHS Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O9:H4 (strain HS) GN=cysN PE=3 SV=1 381 693 1.0E-45
sp|Q1R7U0|CYSN_ECOUT Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain UTI89 / UPEC) GN=cysN PE=3 SV=1 381 693 1.0E-45
sp|Q8FEJ1|CYSN_ECOL6 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysN PE=3 SV=1 381 693 1.0E-45
sp|A1AEU5|CYSN_ECOK1 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O1:K1 / APEC GN=cysN PE=3 SV=1 381 693 1.0E-45
sp|B7MKM5|CYSN_ECO45 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=cysN PE=3 SV=1 381 693 1.0E-45
sp|B5Z3B3|CYSN_ECO5E Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=cysN PE=3 SV=1 381 693 1.0E-45
sp|Q8X7X7|CYSN_ECO57 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O157:H7 GN=cysN PE=3 SV=1 381 693 1.0E-45
sp|Q3YYB1|CYSN_SHISS Sulfate adenylyltransferase subunit 1 OS=Shigella sonnei (strain Ss046) GN=cysN PE=3 SV=1 381 693 1.0E-45
sp|B1LQ72|CYSN_ECOSM Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=cysN PE=3 SV=1 381 693 1.0E-45
sp|P23845|CYSN_ECOLI Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain K12) GN=cysN PE=1 SV=1 381 693 1.0E-45
sp|Q0TEA7|CYSN_ECOL5 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cysN PE=3 SV=1 381 693 1.0E-45
sp|B1XCS7|CYSN_ECODH Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain K12 / DH10B) GN=cysN PE=3 SV=1 381 693 1.0E-45
sp|C4ZZQ5|CYSN_ECOBW Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=cysN PE=3 SV=1 381 693 1.0E-45
sp|B7MZ52|CYSN_ECO81 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O81 (strain ED1a) GN=cysN PE=3 SV=1 381 693 1.0E-45
sp|B7NT95|CYSN_ECO7I Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=cysN PE=3 SV=1 381 693 1.0E-45
sp|P56893|CYSN_RHIME Sulfate adenylyltransferase subunit 1 OS=Rhizobium meliloti (strain 1021) GN=cysN PE=3 SV=1 377 687 2.0E-45
sp|B5BEY8|CYSN_SALPK Sulfate adenylyltransferase subunit 1 OS=Salmonella paratyphi A (strain AKU_12601) GN=cysN PE=3 SV=1 381 693 2.0E-45
sp|Q5PEH2|CYSN_SALPA Sulfate adenylyltransferase subunit 1 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cysN PE=3 SV=1 381 693 2.0E-45
sp|B1IUS8|CYSN_ECOLC Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cysN PE=3 SV=1 381 693 2.0E-45
sp|Q8Z470|CYSN_SALTI Sulfate adenylyltransferase subunit 1 OS=Salmonella typhi GN=cysN PE=3 SV=1 381 693 3.0E-45
sp|A9MF24|CYSN_SALAR Sulfate adenylyltransferase subunit 1 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cysN PE=3 SV=1 381 702 3.0E-45
sp|Q32CH9|CYSN_SHIDS Sulfate adenylyltransferase subunit 1 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=cysN PE=3 SV=1 381 693 3.0E-45
sp|Q8EB10|CYSN_SHEON Sulfate adenylyltransferase subunit 1 OS=Shewanella oneidensis (strain MR-1) GN=cysN PE=3 SV=2 353 687 3.0E-45
sp|B4T461|CYSN_SALNS Sulfate adenylyltransferase subunit 1 OS=Salmonella newport (strain SL254) GN=cysN PE=3 SV=1 381 693 4.0E-45
sp|P13442|NODQ_RHIME Bifunctional enzyme NodQ OS=Rhizobium meliloti (strain 1021) GN=nodQ PE=3 SV=1 365 713 4.0E-45
sp|Q0T1I2|CYSN_SHIF8 Sulfate adenylyltransferase subunit 1 OS=Shigella flexneri serotype 5b (strain 8401) GN=cysN PE=3 SV=1 381 693 4.0E-45
sp|P52978|NODQ_RHITR Bifunctional enzyme NodQ OS=Rhizobium tropici GN=nodQ PE=3 SV=1 381 707 5.0E-45
sp|A7ZQJ5|CYSN_ECO24 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cysN PE=3 SV=1 381 693 5.0E-45
sp|B6I6E1|CYSN_ECOSE Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain SE11) GN=cysN PE=3 SV=1 381 693 6.0E-45
sp|Q83JX8|CYSN_SHIFL Sulfate adenylyltransferase subunit 1 OS=Shigella flexneri GN=cysN PE=3 SV=1 381 693 6.0E-45
sp|Q2NVM8|CYSN_SODGM Sulfate adenylyltransferase subunit 1 OS=Sodalis glossinidius (strain morsitans) GN=cysN PE=3 SV=1 381 702 7.0E-45
sp|P9WNM5|CYSNC_MYCTU Bifunctional enzyme CysN/CysC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysNC PE=1 SV=1 385 713 7.0E-45
sp|P9WNM4|CYSNC_MYCTO Bifunctional enzyme CysN/CysC OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysNC PE=3 SV=1 385 713 7.0E-45
sp|Q66EC7|CYSN_YERPS Sulfate adenylyltransferase subunit 1 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysN PE=3 SV=1 376 693 1.0E-44
sp|Q8ZBP2|CYSN_YERPE Sulfate adenylyltransferase subunit 1 OS=Yersinia pestis GN=cysN PE=3 SV=1 376 693 1.0E-44
sp|A7FLY2|CYSN_YERP3 Sulfate adenylyltransferase subunit 1 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cysN PE=3 SV=1 376 693 1.0E-44
sp|Q7N8L0|CYSN_PHOLL Sulfate adenylyltransferase subunit 1 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysN PE=3 SV=1 381 695 2.0E-44
sp|O07309|NODQ_RHISB Bifunctional enzyme NodQ OS=Rhizobium sp. (strain BR816) GN=nodQ PE=3 SV=1 365 707 2.0E-44
sp|A1ST27|CYSN_PSYIN Sulfate adenylyltransferase subunit 1 OS=Psychromonas ingrahamii (strain 37) GN=cysN PE=3 SV=1 365 686 5.0E-44
sp|Q6LM69|CYSN_PHOPR Sulfate adenylyltransferase subunit 1 OS=Photobacterium profundum GN=cysN PE=3 SV=1 381 693 3.0E-42
sp|P57498|CYSN_BUCAI Sulfate adenylyltransferase subunit 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=cysN PE=3 SV=1 352 688 2.0E-41
sp|B8D7V3|CYSN_BUCAT Sulfate adenylyltransferase subunit 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=cysN PE=3 SV=1 352 688 2.0E-41
sp|B8D9K1|CYSN_BUCA5 Sulfate adenylyltransferase subunit 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=cysN PE=3 SV=1 352 688 3.0E-41
sp|Q8SS29|EF1A_ENCCU Elongation factor 1-alpha OS=Encephalitozoon cuniculi (strain GB-M1) GN=TEF1 PE=1 SV=2 374 672 1.0E-39
sp|A5D5I8|EFTU2_PELTS Elongation factor Tu 2 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=tuf2 PE=3 SV=1 368 787 2.0E-37
sp|A5D5K0|EFTU1_PELTS Elongation factor Tu 1 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=tuf1 PE=3 SV=1 368 787 5.0E-37
sp|P28604|NODQ_AZOBR Bifunctional enzyme NodQ OS=Azospirillum brasilense GN=nodQ PE=3 SV=2 381 677 6.0E-37
sp|Q07051|EF1A_EIMBO Elongation factor 1-alpha (Fragment) OS=Eimeria bovis PE=2 SV=1 476 788 6.0E-37
sp|B9MQH1|EFTU_CALBD Elongation factor Tu OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=tuf PE=3 SV=1 375 785 4.0E-35
sp|A4XI37|EFTU_CALS8 Elongation factor Tu OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=tuf PE=3 SV=1 375 785 2.0E-34
sp|Q46IW4|EFTU_PROMT Elongation factor Tu OS=Prochlorococcus marinus (strain NATL2A) GN=tuf PE=3 SV=1 368 787 2.0E-34
sp|A2C4U5|EFTU_PROM1 Elongation factor Tu OS=Prochlorococcus marinus (strain NATL1A) GN=tuf PE=3 SV=1 368 787 5.0E-34
sp|A5GW14|EFTU_SYNR3 Elongation factor Tu OS=Synechococcus sp. (strain RCC307) GN=tuf PE=3 SV=1 368 787 6.0E-34
sp|Q0AUG3|EFTU2_SYNWW Elongation factor Tu 2 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=tuf2 PE=3 SV=1 384 787 6.0E-34
sp|Q0AUH8|EFTU1_SYNWW Elongation factor Tu 1 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=tuf1 PE=3 SV=1 384 787 2.0E-33
sp|P33165|EFTU_BACFR Elongation factor Tu OS=Bacteroides fragilis (strain YCH46) GN=tuf PE=3 SV=1 368 785 2.0E-33
sp|Q5L890|EFTU_BACFN Elongation factor Tu OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=tuf PE=3 SV=1 368 785 2.0E-33
sp|A5N4N1|EFTU_CLOK5 Elongation factor Tu OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=tuf1 PE=3 SV=1 368 787 3.0E-33
sp|Q250N4|EFTU_DESHY Elongation factor Tu OS=Desulfitobacterium hafniense (strain Y51) GN=tuf PE=3 SV=1 368 787 3.0E-33
sp|B8G1W4|EFTU_DESHD Elongation factor Tu OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=tuf PE=3 SV=1 368 787 3.0E-33
sp|Q7V500|EFTU_PROMM Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9313) GN=tuf PE=3 SV=1 368 787 3.0E-33
sp|B2GIL2|EFTU_KOCRD Elongation factor Tu OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=tuf PE=3 SV=1 384 785 5.0E-33
sp|A5GIP0|EFTU_SYNPW Elongation factor Tu OS=Synechococcus sp. (strain WH7803) GN=tuf PE=3 SV=1 368 787 6.0E-33
sp|Q05FI3|EFTU_CARRP Elongation factor Tu OS=Carsonella ruddii (strain PV) GN=tuf PE=3 SV=1 384 787 7.0E-33
sp|B0TC54|EFTU_HELMI Elongation factor Tu OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=tuf PE=3 SV=1 375 787 9.0E-33
sp|A6Q1L5|EFTU_NITSB Elongation factor Tu OS=Nitratiruptor sp. (strain SB155-2) GN=tuf PE=3 SV=1 374 787 1.0E-32
sp|A1SNN5|EFTU_NOCSJ Elongation factor Tu OS=Nocardioides sp. (strain BAA-499 / JS614) GN=tuf PE=3 SV=1 375 785 2.0E-32
sp|A6LLL1|EFTU_THEM4 Elongation factor Tu OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=tuf PE=3 SV=1 375 787 2.0E-32
sp|A5DN78|EFTU_PICGU Elongation factor Tu, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TUF1 PE=3 SV=1 375 787 3.0E-32
sp|Q5YPG4|EFTU_NOCFA Elongation factor Tu OS=Nocardia farcinica (strain IFM 10152) GN=tuf PE=3 SV=2 375 785 3.0E-32
sp|A2CC87|EFTU_PROM3 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9303) GN=tuf PE=3 SV=1 368 787 3.0E-32
sp|Q2RFP5|EFTU_MOOTA Elongation factor Tu OS=Moorella thermoacetica (strain ATCC 39073) GN=tuf PE=3 SV=1 368 787 4.0E-32
sp|O21245|EFTU_RECAM Elongation factor Tu, mitochondrial OS=Reclinomonas americana GN=TUFA PE=3 SV=1 368 787 4.0E-32
sp|A6KYK9|EFTU_BACV8 Elongation factor Tu OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=tuf PE=3 SV=1 368 785 5.0E-32
sp|Q74JU6|EFTU_LACJO Elongation factor Tu OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=tuf PE=3 SV=1 371 785 6.0E-32
sp|Q7U4D1|EFTU_SYNPX Elongation factor Tu OS=Synechococcus sp. (strain WH8102) GN=tuf PE=3 SV=1 368 787 6.0E-32
sp|Q7UZY7|EFTU_PROMP Elongation factor Tu OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=tuf PE=3 SV=1 368 787 6.0E-32
sp|A2BYN4|EFTU_PROM5 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9515) GN=tuf PE=3 SV=1 368 787 6.0E-32
sp|Q042T5|EFTU_LACGA Elongation factor Tu OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=tuf PE=3 SV=2 371 785 7.0E-32
sp|A4FPM7|EFTU_SACEN Elongation factor Tu OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=tuf PE=3 SV=1 384 785 7.0E-32
sp|A3PEZ7|EFTU_PROM0 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9301) GN=tuf PE=3 SV=1 368 787 9.0E-32
sp|Q8EX18|EFTU_MYCPE Elongation factor Tu OS=Mycoplasma penetrans (strain HF-2) GN=tuf PE=3 SV=1 368 787 1.0E-31
sp|A8G708|EFTU_PROM2 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9215) GN=tuf PE=3 SV=1 368 787 1.0E-31
sp|A2BT83|EFTU_PROMS Elongation factor Tu OS=Prochlorococcus marinus (strain AS9601) GN=tuf PE=3 SV=1 368 787 1.0E-31
sp|Q3AMT6|EFTU_SYNSC Elongation factor Tu OS=Synechococcus sp. (strain CC9605) GN=tuf PE=3 SV=1 368 787 1.0E-31
sp|A0LRL8|EFTU_ACIC1 Elongation factor Tu OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=tuf PE=3 SV=1 375 785 1.0E-31
sp|B6YQ04|EFTU_AZOPC Elongation factor Tu OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=tuf PE=3 SV=1 373 785 1.0E-31
sp|Q318N5|EFTU_PROM9 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9312) GN=tuf PE=3 SV=1 368 787 1.0E-31
sp|Q6MU81|EFTU_MYCMS Elongation factor Tu OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=tuf PE=3 SV=1 384 787 2.0E-31
sp|Q2SSW8|EFTU_MYCCT Elongation factor Tu OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=tuf PE=3 SV=1 384 787 2.0E-31
sp|Q47LJ1|EFTU_THEFY Elongation factor Tu OS=Thermobifida fusca (strain YX) GN=tuf PE=3 SV=1 375 785 2.0E-31
sp|A7ZCN0|EFTU_CAMC1 Elongation factor Tu OS=Campylobacter concisus (strain 13826) GN=tuf PE=3 SV=1 373 787 2.0E-31
sp|C5C0J3|EFTU_BEUC1 Elongation factor Tu OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=tuf PE=3 SV=1 375 785 2.0E-31
sp|Q255F3|EFTU_CHLFF Elongation factor Tu OS=Chlamydophila felis (strain Fe/C-56) GN=tuf PE=3 SV=1 368 787 2.0E-31
sp|A9BHA7|EFTU_PETMO Elongation factor Tu OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=tuf PE=3 SV=1 384 787 2.0E-31
sp|B2RL52|EFTU_PORG3 Elongation factor Tu OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=tuf PE=3 SV=1 373 785 2.0E-31
sp|A6LPP6|EFTU_CLOB8 Elongation factor Tu OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=tuf1 PE=3 SV=1 375 787 2.0E-31
sp|Q9Z9A7|EFTU_CHLPN Elongation factor Tu OS=Chlamydia pneumoniae GN=tuf PE=3 SV=3 368 787 3.0E-31
sp|A9BCK0|EFTU_PROM4 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9211) GN=tuf PE=3 SV=1 368 787 3.0E-31
sp|A0RQJ3|EFTU_CAMFF Elongation factor Tu OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=tuf PE=3 SV=1 373 787 3.0E-31
sp|Q5HVZ7|EFTU_CAMJR Elongation factor Tu OS=Campylobacter jejuni (strain RM1221) GN=tuf PE=3 SV=1 373 787 3.0E-31
sp|A1VYI6|EFTU_CAMJJ Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=tuf PE=3 SV=1 373 787 3.0E-31
sp|O69303|EFTU_CAMJE Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=tuf PE=3 SV=1 373 787 3.0E-31
sp|A7H4R3|EFTU_CAMJD Elongation factor Tu OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=tuf PE=3 SV=1 373 787 3.0E-31
sp|A8FKQ5|EFTU_CAMJ8 Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=tuf PE=3 SV=1 373 787 3.0E-31
sp|A6LE88|EFTU_PARD8 Elongation factor Tu OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=tuf PE=3 SV=1 375 785 3.0E-31
sp|A8F4Q9|EFTU_PSELT Elongation factor Tu OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=tuf PE=3 SV=1 384 787 4.0E-31
sp|Q7VA05|EFTU_PROMA Elongation factor Tu OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=tuf PE=3 SV=1 368 787 5.0E-31
sp|Q8A463|EFTU_BACTN Elongation factor Tu OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=tuf PE=3 SV=1 368 785 5.0E-31
sp|Q822I4|EFTU_CHLCV Elongation factor Tu OS=Chlamydophila caviae (strain GPIC) GN=tuf PE=3 SV=3 368 787 5.0E-31
sp|A0JZ88|EFTU_ARTS2 Elongation factor Tu OS=Arthrobacter sp. (strain FB24) GN=tuf PE=3 SV=1 375 785 6.0E-31
sp|P42480|EFTU_HYMOC Elongation factor Tu OS=Hymenobacter ocellatus GN=tuf PE=3 SV=1 375 785 6.0E-31
sp|B9K884|EFTU_THENN Elongation factor Tu OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=tuf PE=3 SV=1 384 787 7.0E-31
sp|Q5L5H6|EFTU_CHLAB Elongation factor Tu OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=tuf PE=3 SV=1 368 787 7.0E-31
sp|B8HD11|EFTU_ARTCA Elongation factor Tu OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=tuf PE=3 SV=1 375 785 7.0E-31
sp|B6JN44|EFTU_HELP2 Elongation factor Tu OS=Helicobacter pylori (strain P12) GN=tuf PE=3 SV=1 373 787 8.0E-31
sp|P56003|EFTU_HELPY Elongation factor Tu OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=tuf PE=3 SV=1 373 787 8.0E-31
sp|P02992|EFTU_YEAST Elongation factor Tu, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUF1 PE=1 SV=1 375 787 9.0E-31
sp|A4J0Z5|EFTU_DESRM Elongation factor Tu OS=Desulfotomaculum reducens (strain MI-1) GN=tuf PE=3 SV=1 375 787 9.0E-31
sp|Q3A9R3|EFTU1_CARHZ Elongation factor Tu 1 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tuf1 PE=3 SV=1 384 787 1.0E-30
sp|Q6A6L7|EFTU_PROAC Elongation factor Tu OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=tuf PE=3 SV=1 375 785 1.0E-30
sp|Q0I0B9|EFTU1_SHESR Elongation factor Tu 1 OS=Shewanella sp. (strain MR-7) GN=tuf1 PE=3 SV=1 384 787 1.0E-30
sp|Q0HNV1|EFTU1_SHESM Elongation factor Tu 1 OS=Shewanella sp. (strain MR-4) GN=tuf1 PE=3 SV=1 384 787 1.0E-30
sp|Q11Q98|EFTU_CYTH3 Elongation factor Tu OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=tuf PE=3 SV=1 372 785 1.0E-30
sp|B0SSH9|EFTU_LEPBP Elongation factor Tu OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=tuf PE=3 SV=1 421 787 1.0E-30
sp|B0SAF6|EFTU_LEPBA Elongation factor Tu OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=tuf PE=3 SV=1 421 787 1.0E-30
sp|A1WVD6|EFTU2_HALHL Elongation factor Tu 2 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=tuf2 PE=3 SV=1 384 787 1.0E-30
sp|B5Z8K3|EFTU_HELPG Elongation factor Tu OS=Helicobacter pylori (strain G27) GN=tuf PE=3 SV=1 373 787 1.0E-30
sp|Q2JUX4|EFTU_SYNJA Elongation factor Tu OS=Synechococcus sp. (strain JA-3-3Ab) GN=tuf PE=3 SV=1 384 787 2.0E-30
sp|A8MLC4|EFTU_ALKOO Elongation factor Tu OS=Alkaliphilus oremlandii (strain OhILAs) GN=tuf1 PE=3 SV=1 375 787 2.0E-30
sp|A1T4L6|EFTU_MYCVP Elongation factor Tu OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=tuf PE=3 SV=1 375 785 2.0E-30
sp|A1WVC4|EFTU1_HALHL Elongation factor Tu 1 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=tuf1 PE=3 SV=1 384 787 2.0E-30
sp|P13537|EFTU_THEMA Elongation factor Tu OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=tuf PE=3 SV=2 375 787 2.0E-30
sp|Q0I0A7|EFTU2_SHESR Elongation factor Tu 2 OS=Shewanella sp. (strain MR-7) GN=tuf2 PE=3 SV=1 384 787 2.0E-30
sp|P40175|EFTU3_STRCO Elongation factor Tu-3 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=tuf3 PE=3 SV=2 384 785 2.0E-30
sp|B1LBP2|EFTU_THESQ Elongation factor Tu OS=Thermotoga sp. (strain RQ2) GN=tuf PE=3 SV=1 384 787 2.0E-30
sp|A5IM81|EFTU_THEP1 Elongation factor Tu OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=tuf PE=3 SV=1 384 787 2.0E-30
sp|Q04B37|EFTU_LACDB Elongation factor Tu OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=tuf PE=3 SV=1 375 785 2.0E-30
sp|Q1GAQ0|EFTU_LACDA Elongation factor Tu OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=tuf PE=3 SV=1 375 785 2.0E-30
sp|Q01SX2|EFTU_SOLUE Elongation factor Tu OS=Solibacter usitatus (strain Ellin6076) GN=tuf1 PE=3 SV=1 375 785 2.0E-30
sp|A7GZK6|EFTU_CAMC5 Elongation factor Tu OS=Campylobacter curvus (strain 525.92) GN=tuf PE=3 SV=1 373 787 2.0E-30
sp|A8YUS2|EFTU_LACH4 Elongation factor Tu OS=Lactobacillus helveticus (strain DPC 4571) GN=tuf PE=3 SV=1 375 785 2.0E-30
sp|Q9TJQ8|EFTU_PROWI Elongation factor Tu, plastid OS=Prototheca wickerhamii GN=tufA PE=3 SV=1 384 787 2.0E-30
sp|B2UUW8|EFTU_HELPS Elongation factor Tu OS=Helicobacter pylori (strain Shi470) GN=tuf PE=3 SV=1 373 787 2.0E-30
sp|B3QZH5|EFTU_PHYMT Elongation factor Tu OS=Phytoplasma mali (strain AT) GN=tuf PE=3 SV=1 384 785 3.0E-30
sp|Q3A9P8|EFTU2_CARHZ Elongation factor Tu 2 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tuf2 PE=3 SV=1 384 787 3.0E-30
sp|A9WSW5|EFTU_RENSM Elongation factor Tu OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=tuf PE=3 SV=1 375 785 3.0E-30
sp|Q7VJ74|EFTU_HELHP Elongation factor Tu OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=tuf PE=3 SV=1 384 787 3.0E-30
sp|B7IHU4|EFTU_THEAB Elongation factor Tu OS=Thermosipho africanus (strain TCF52B) GN=tuf PE=3 SV=1 375 787 3.0E-30
sp|P33166|EFTU_BACSU Elongation factor Tu OS=Bacillus subtilis (strain 168) GN=tuf PE=3 SV=1 375 787 4.0E-30
sp|Q9ZEU3|EFTU_APPPP Elongation factor Tu OS=Apple proliferation phytoplasma GN=tuf PE=3 SV=1 384 785 4.0E-30
sp|Q2S1P8|EFTU_SALRD Elongation factor Tu OS=Salinibacter ruber (strain DSM 13855 / M31) GN=tuf1 PE=3 SV=1 384 787 4.0E-30
sp|P29544|EFTU3_STRRA Elongation factor Tu-3 OS=Streptomyces ramocissimus GN=tuf3 PE=3 SV=1 384 785 5.0E-30
sp|A8F982|EFTU_BACP2 Elongation factor Tu OS=Bacillus pumilus (strain SAFR-032) GN=tuf PE=3 SV=1 375 787 6.0E-30
sp|Q826Z7|EFTU2_STRAW Elongation factor Tu 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=tuf2 PE=3 SV=1 384 785 6.0E-30
sp|P49410|EFTU_BOVIN Elongation factor Tu, mitochondrial OS=Bos taurus GN=TUFM PE=1 SV=1 361 787 7.0E-30
sp|Q1RHL9|EFTU_RICBR Elongation factor Tu OS=Rickettsia bellii (strain RML369-C) GN=tuf PE=3 SV=1 375 787 8.0E-30
sp|A8GVB2|EFTU_RICB8 Elongation factor Tu OS=Rickettsia bellii (strain OSU 85-389) GN=tuf PE=3 SV=1 375 787 8.0E-30
sp|A1R8U9|EFTU_ARTAT Elongation factor Tu OS=Arthrobacter aurescens (strain TC1) GN=tuf PE=3 SV=1 375 785 9.0E-30
sp|A0KRL0|EFTU_SHESA Elongation factor Tu OS=Shewanella sp. (strain ANA-3) GN=tuf1 PE=3 SV=1 384 787 9.0E-30
sp|C4LL63|EFTU_CORK4 Elongation factor Tu OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=tuf PE=3 SV=1 375 785 9.0E-30
sp|Q6AP73|EFTU2_DESPS Elongation factor Tu 2 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=tuf2 PE=3 SV=1 368 787 9.0E-30
sp|A7GJ76|EFTU_CLOBL Elongation factor Tu OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=tuf1 PE=3 SV=1 375 787 1.0E-29
sp|B1IGF6|EFTU_CLOBK Elongation factor Tu OS=Clostridium botulinum (strain Okra / Type B1) GN=tuf1 PE=3 SV=1 375 787 1.0E-29
sp|A5I7K8|EFTU_CLOBH Elongation factor Tu OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=tuf1 PE=3 SV=1 375 787 1.0E-29
sp|A7FZ71|EFTU_CLOB1 Elongation factor Tu OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=tuf1 PE=3 SV=1 375 787 1.0E-29
sp|B9KFF9|EFTU_CAMLR Elongation factor Tu OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=tuf PE=3 SV=1 373 787 1.0E-29
sp|Q28UW7|EFTU_JANSC Elongation factor Tu OS=Jannaschia sp. (strain CCS1) GN=tuf1 PE=3 SV=1 368 787 1.0E-29
sp|P18906|EFTU_MYCGA Elongation factor Tu OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=tuf PE=3 SV=1 375 787 1.0E-29
sp|Q6F0J5|EFTU_MESFL Elongation factor Tu OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=tuf PE=3 SV=1 384 785 1.0E-29
sp|Q83GW1|EFTU_TROWT Elongation factor Tu OS=Tropheryma whipplei (strain Twist) GN=tuf PE=3 SV=1 384 787 1.0E-29
sp|A3DJ00|EFTU_CLOTH Elongation factor Tu OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=tuf PE=3 SV=1 375 785 1.0E-29
sp|Q5FKR8|EFTU_LACAC Elongation factor Tu OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=tuf PE=3 SV=1 375 785 1.0E-29
sp|Q8EK70|EFTU2_SHEON Elongation factor Tu 2 OS=Shewanella oneidensis (strain MR-1) GN=tuf2 PE=3 SV=1 375 787 1.0E-29
sp|B1KSM7|EFTU_CLOBM Elongation factor Tu OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=tuf1 PE=3 SV=1 375 787 1.0E-29
sp|Q0HNT9|EFTU2_SHESM Elongation factor Tu 2 OS=Shewanella sp. (strain MR-4) GN=tuf2 PE=3 SV=1 384 787 1.0E-29
sp|Q0BUQ2|EFTU_GRABC Elongation factor Tu OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=tuf PE=3 SV=1 384 787 2.0E-29
sp|Q1IHG6|EFTU_KORVE Elongation factor Tu OS=Koribacter versatilis (strain Ellin345) GN=tuf1 PE=3 SV=1 375 787 2.0E-29
sp|Q8XGZ0|EFTU_RALSO Elongation factor Tu OS=Ralstonia solanacearum (strain GMI1000) GN=tufA PE=3 SV=1 368 787 2.0E-29
sp|Q33451|EFTU_EIMTE Elongation factor Tu, apicoplast OS=Eimeria tenella GN=tufA PE=3 SV=1 370 787 2.0E-29
sp|Q21SF0|EFTU1_RHOFT Elongation factor Tu 1 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=tuf1 PE=3 SV=1 373 787 2.0E-29
sp|B3WE38|EFTU_LACCB Elongation factor Tu OS=Lactobacillus casei (strain BL23) GN=tuf PE=3 SV=1 371 787 2.0E-29
sp|Q039K9|EFTU_LACC3 Elongation factor Tu OS=Lactobacillus casei (strain ATCC 334) GN=tuf PE=3 SV=1 371 787 2.0E-29
sp|Q21RV6|EFTU2_RHOFT Elongation factor Tu 2 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=tuf2 PE=3 SV=1 373 787 2.0E-29
sp|A8F2E9|EFTU_RICM5 Elongation factor Tu OS=Rickettsia massiliae (strain Mtu5) GN=tuf PE=3 SV=2 375 787 2.0E-29
sp|P42481|EFTU_THIDL Elongation factor Tu OS=Thiomonas delicata GN=tuf PE=3 SV=1 372 787 2.0E-29
sp|Q83NT9|EFTU_TROW8 Elongation factor Tu OS=Tropheryma whipplei (strain TW08/27) GN=tuf PE=3 SV=1 384 787 2.0E-29
sp|C4Z2R9|EFTU_EUBE2 Elongation factor Tu OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=tuf PE=3 SV=1 375 785 2.0E-29
sp|A1VIP8|EFTU_POLNA Elongation factor Tu OS=Polaromonas naphthalenivorans (strain CJ2) GN=tuf1 PE=3 SV=1 373 787 3.0E-29
sp|P02991|EFTU_EUGGR Elongation factor Tu, chloroplastic OS=Euglena gracilis GN=tufA PE=1 SV=1 368 787 3.0E-29
sp|A0QS98|EFTU_MYCS2 Elongation factor Tu OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=tuf PE=1 SV=1 375 785 3.0E-29
sp|Q8R7T8|EFTU2_CALS4 Elongation factor Tu-B OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tufB PE=3 SV=1 368 787 3.0E-29
sp|Q65PA9|EFTU_BACLD Elongation factor Tu OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=tuf PE=3 SV=1 375 787 4.0E-29
sp|A1S204|EFTU_SHEAM Elongation factor Tu OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=tuf1 PE=3 SV=1 384 787 4.0E-29
sp|Q9Y700|EFTU_SCHPO Elongation factor Tu, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tuf1 PE=3 SV=1 384 787 4.0E-29
sp|Q72GW4|EFTU_THET2 Elongation factor Tu OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=tuf1 PE=3 SV=1 384 787 4.0E-29
sp|P09953|EFTU_MICLU Elongation factor Tu OS=Micrococcus luteus GN=tuf PE=3 SV=1 375 785 4.0E-29
sp|Q9PK73|EFTU_CHLMU Elongation factor Tu OS=Chlamydia muridarum (strain MoPn / Nigg) GN=tuf PE=3 SV=3 368 787 5.0E-29
sp|B5ZC31|EFTU_UREU1 Elongation factor Tu OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=tuf PE=3 SV=1 384 785 5.0E-29
sp|Q211E6|EFTU_RHOPB Elongation factor Tu OS=Rhodopseudomonas palustris (strain BisB18) GN=tuf PE=3 SV=1 375 787 5.0E-29
sp|Q1WU83|EFTU_LACS1 Elongation factor Tu OS=Lactobacillus salivarius (strain UCC118) GN=tuf PE=3 SV=1 375 787 6.0E-29
sp|B2G6R2|EFTU_LACRJ Elongation factor Tu OS=Lactobacillus reuteri (strain JCM 1112) GN=tuf PE=3 SV=1 371 787 6.0E-29
sp|A5VJ92|EFTU_LACRD Elongation factor Tu OS=Lactobacillus reuteri (strain DSM 20016) GN=tuf PE=3 SV=1 371 787 6.0E-29
sp|Q8R7V2|EFTU1_CALS4 Elongation factor Tu-A OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tufA PE=3 SV=1 368 787 6.0E-29
sp|Q38WR7|EFTU_LACSS Elongation factor Tu OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=tuf PE=3 SV=1 371 787 6.0E-29
sp|Q0SQC8|EFTU_CLOPS Elongation factor Tu OS=Clostridium perfringens (strain SM101 / Type A) GN=tuf1 PE=3 SV=1 375 787 6.0E-29
sp|Q8XFP8|EFTU_CLOPE Elongation factor Tu OS=Clostridium perfringens (strain 13 / Type A) GN=tufA PE=3 SV=1 375 787 6.0E-29
sp|Q0TMN0|EFTU_CLOP1 Elongation factor Tu OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=tuf1 PE=3 SV=1 375 787 6.0E-29
sp|Q8EK81|EFTU1_SHEON Elongation factor Tu 1 OS=Shewanella oneidensis (strain MR-1) GN=tuf1 PE=3 SV=1 375 787 7.0E-29
sp|Q01698|EFTU_THEAQ Elongation factor Tu OS=Thermus aquaticus GN=tuf PE=1 SV=2 384 787 7.0E-29
sp|P23568|EFTU_MYCPN Elongation factor Tu OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=tuf PE=3 SV=2 375 785 7.0E-29
sp|B0JSE0|EFTU_MICAN Elongation factor Tu OS=Microcystis aeruginosa (strain NIES-843) GN=tuf PE=3 SV=1 375 787 7.0E-29
sp|Q4FLK5|EFTU_PELUB Elongation factor Tu OS=Pelagibacter ubique (strain HTCC1062) GN=tuf PE=3 SV=1 431 787 8.0E-29
sp|Q3BWY6|EFTU_XANC5 Elongation factor Tu OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=tuf1 PE=3 SV=1 384 787 8.0E-29
sp|Q8NL22|EFTU_XANAC Elongation factor Tu OS=Xanthomonas axonopodis pv. citri (strain 306) GN=tufA PE=3 SV=1 384 787 8.0E-29
sp|Q5GWR8|EFTU_XANOR Elongation factor Tu OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=tuf1 PE=3 SV=1 384 787 8.0E-29
sp|Q2NZX1|EFTU_XANOM Elongation factor Tu OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=tuf1 PE=3 SV=1 384 787 8.0E-29
sp|A8GT71|EFTU_RICRS Elongation factor Tu OS=Rickettsia rickettsii (strain Sheila Smith) GN=tuf PE=3 SV=1 375 787 8.0E-29
sp|B0BUR2|EFTU_RICRO Elongation factor Tu OS=Rickettsia rickettsii (strain Iowa) GN=tuf PE=3 SV=1 375 787 8.0E-29
sp|C4K2I2|EFTU_RICPU Elongation factor Tu OS=Rickettsia peacockii (strain Rustic) GN=tuf PE=3 SV=1 375 787 8.0E-29
sp|C3PPA9|EFTU_RICAE Elongation factor Tu OS=Rickettsia africae (strain ESF-5) GN=tuf PE=3 SV=1 375 787 8.0E-29
sp|Q5NQ65|EFTU_ZYMMO Elongation factor Tu OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=tuf PE=3 SV=1 384 787 8.0E-29
sp|Q92GW4|EFTU_RICCN Elongation factor Tu OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=tuf PE=3 SV=1 375 787 9.0E-29
sp|C4ZB99|EFTU_EUBR3 Elongation factor Tu OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=tuf PE=3 SV=1 375 785 9.0E-29
sp|Q8KTA1|EFTU_RICMO Elongation factor Tu OS=Rickettsia montanensis GN=tuf PE=3 SV=1 375 787 1.0E-28
sp|Q54HB2|EFTU_DICDI Elongation factor Tu, mitochondrial OS=Dictyostelium discoideum GN=tufm PE=1 SV=2 384 787 1.0E-28
sp|P42482|EFTU_WOLSU Elongation factor Tu OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=tuf PE=3 SV=2 384 787 1.0E-28
sp|P60338|EFTU1_THETH Elongation factor Tu-A OS=Thermus thermophilus GN=tufA PE=1 SV=2 384 787 1.0E-28
sp|Q5SHN6|EFTU1_THET8 Elongation factor Tu-A OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tufA PE=1 SV=3 384 787 1.0E-28
sp|P13927|EFTU_MYCGE Elongation factor Tu OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=tuf PE=3 SV=1 375 787 1.0E-28
sp|Q0K5Z9|EFTU_CUPNH Elongation factor Tu OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=tuf1 PE=3 SV=1 368 787 1.0E-28
sp|P60339|EFTU2_THET8 Elongation factor Tu-B OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tufB PE=1 SV=2 384 787 1.0E-28
sp|Q1D776|EFTU2_MYXXD Elongation factor Tu 2 OS=Myxococcus xanthus (strain DK 1622) GN=tuf2 PE=3 SV=1 368 787 1.0E-28
sp|Q1D7V1|EFTU1_MYXXD Elongation factor Tu 1 OS=Myxococcus xanthus (strain DK 1622) GN=tuf1 PE=3 SV=1 368 787 1.0E-28
sp|Q3AW53|EFTU_SYNS9 Elongation factor Tu OS=Synechococcus sp. (strain CC9902) GN=tuf PE=3 SV=1 368 787 1.0E-28
sp|Q8KTA6|EFTU_RICPA Elongation factor Tu OS=Rickettsia parkeri GN=tuf PE=3 SV=1 375 787 1.0E-28
sp|Q134R0|EFTU2_RHOPS Elongation factor Tu 2 OS=Rhodopseudomonas palustris (strain BisB5) GN=tuf2 PE=3 SV=1 375 787 1.0E-28
sp|A7HM54|EFTU_FERNB Elongation factor Tu OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=tuf PE=3 SV=1 384 787 1.0E-28
sp|P50371|EFTU_CHACO Elongation factor Tu, chloroplastic OS=Chara connivens GN=tufA PE=3 SV=1 370 787 1.0E-28
sp|Q1LSY4|EFTU_BAUCH Elongation factor Tu OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=tuf PE=3 SV=1 368 787 1.0E-28
sp|Q134S7|EFTU1_RHOPS Elongation factor Tu 1 OS=Rhodopseudomonas palustris (strain BisB5) GN=tuf1 PE=3 SV=1 375 787 1.0E-28
sp|Q6ACZ0|EFTU_LEIXX Elongation factor Tu OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=tuf PE=3 SV=1 369 785 1.0E-28
sp|Q6AP86|EFTU1_DESPS Elongation factor Tu 1 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=tuf1 PE=3 SV=1 368 787 1.0E-28
sp|A5CCA0|EFTU1_ORITB Elongation factor Tu 1 OS=Orientia tsutsugamushi (strain Boryong) GN=tuf1 PE=3 SV=1 384 785 2.0E-28
sp|Q6YQV8|EFTU_ONYPE Elongation factor Tu OS=Onion yellows phytoplasma (strain OY-M) GN=tuf PE=3 SV=1 384 785 2.0E-28
sp|A5V604|EFTU_SPHWW Elongation factor Tu OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=tuf PE=3 SV=1 384 787 2.0E-28
sp|Q9Z9L6|EFTU_BACHD Elongation factor Tu OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=tuf PE=3 SV=1 375 787 2.0E-28
sp|P85834|EFTU_RAT Elongation factor Tu, mitochondrial OS=Rattus norvegicus GN=Tufm PE=1 SV=1 349 787 2.0E-28
[Show less]

GO

GO Term Description Terminal node
GO:0003924 GTPase activity Yes
GO:0005525 GTP binding Yes
GO:0016462 pyrophosphatase activity No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0036094 small molecule binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0032555 purine ribonucleotide binding No
GO:0019001 guanyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1241
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|550 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|886
Ophiocordyceps camponoti-floridani Ophcf2|01528
Ophiocordyceps camponoti-rufipedis Ophun1|127
Ophiocordyceps kimflemingae Ophio5|7216
Ophiocordyceps subramaniannii Hirsu2|10437

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|550
MAEILEDDLIDYQDDYDDDEFSAEDHEAMKTGTAEVRLALGPDASKVTVTQIQDSLWHYYYDVDKSVAYLRRTFI
SPAPKPASKPTSKSTIKPNNKSPEGKLDDAPFLEALSLFVRAAGAHRGSPSAPVQTRRCLPTEFDDMPWLHVPEH
RIAHLIPPVQPQGGLLGGGDGSPRMSKLQALAAARKKKQDEKKEMDRTMQTEAGIKRLSISHHVQESEVSSPKRH
KGSEMFSPRPSISSPTTPASMEQALLHDPSPHVDSATRLTPSALAQTLFDPTPARLLNRPEFFAMPYASSCVFSC
AAFSQPSPDDVVLAAQAQAGKKAPSKTKKSEDRNTSNAGDKQAQAVEGLSTLKINDSAPKTKGLDVIQEFQKSNS
KRSTSFVVVGHVDAGKSTLMGRLLLELKHVEQRTVDKYRRQAEKTGKQSFALAWVMDQGSEERDRGVTMDIATNH
FETPMTRFTILDAPGHRDFVPNMIAGASQADLAILVVDANTGAFEKGLKGQTREHVLLLRSLGVQRLIVAVNKLD
MVAWSKERFEEIREQVGGFLTGLGFQSKHVSFIPISGLNGDNVAFKVKDAAASWYTGSTLMEALEAPGPSTMTKM
LEKSFRMPILEVFRSPQQGTTTLAGRIDAGTVQVGDEVLVQPSGEAAYVKSIMVDTESQDWAVAGQSVSISLANI
DAVHIRVGDIVCDAKQPILCGDFFTIKAMAFDHVVPMPVDLHRGRLHVAGQIESMVALLDKATGTIIKKKPRVVQ
PGGVARMVIRLNTKVPLEAGQRVVIRSGGETIAAGLLE*
Coding >OphauG2|550
ATGGCCGAAATCCTTGAGGACGACTTGATTGACTATCAAGACGATTATGACGATGACGAATTCAGCGCCGAGGAC
CACGAGGCAATGAAGACGGGCACTGCCGAGGTGCGGCTTGCACTGGGGCCCGACGCCTCCAAGGTGACGGTGACA
CAGATTCAAGACTCTCTATGGCATTACTACTATGATGTCGACAAGTCGGTTGCCTATCTGCGACGTACTTTCATT
TCTCCTGCGCCCAAGCCCGCTTCAAAACCAACTTCCAAATCGACCATCAAGCCTAACAATAAGTCGCCAGAGGGT
AAGTTGGACGATGCCCCCTTTCTCGAAGCTCTTAGCCTGTTTGTCCGGGCCGCTGGAGCACATCGTGGGTCGCCG
TCAGCGCCAGTACAGACTCGCCGGTGTCTGCCTACAGAGTTTGACGACATGCCTTGGTTGCATGTTCCGGAGCAT
CGAATAGCCCATCTCATTCCCCCTGTGCAACCCCAAGGCGGGCTGTTGGGTGGTGGCGATGGCTCTCCGCGCATG
TCAAAGCTACAAGCTCTTGCAGCTGCAAGGAAAAAAAAGCAGGATGAGAAGAAGGAGATGGACAGGACGATGCAG
ACCGAAGCTGGCATCAAGCGATTATCCATTTCGCACCATGTTCAAGAGTCAGAGGTATCCTCTCCCAAACGACAC
AAGGGTTCGGAAATGTTTTCTCCTCGGCCATCAATTTCATCTCCTACTACTCCAGCCTCGATGGAGCAGGCGCTC
CTACACGACCCTTCGCCACATGTAGACAGTGCCACGAGGTTGACTCCGTCTGCCTTGGCTCAAACGCTCTTCGAT
CCTACGCCAGCCCGCCTATTGAACAGGCCAGAATTCTTTGCCATGCCTTATGCATCTTCATGCGTCTTTTCCTGT
GCTGCTTTTTCCCAACCCAGCCCCGACGACGTTGTGCTCGCGGCCCAGGCGCAAGCGGGTAAGAAGGCACCGTCC
AAGACCAAAAAGTCGGAGGATAGAAACACGAGCAATGCCGGTGACAAGCAGGCGCAAGCAGTCGAGGGACTGTCA
ACACTCAAGATTAACGATTCAGCGCCCAAAACCAAGGGTCTCGATGTCATTCAAGAGTTTCAGAAAAGCAACAGC
AAACGGAGCACCAGCTTTGTTGTCGTTGGCCACGTGGATGCTGGCAAGAGTACGCTCATGGGTCGGCTATTACTC
GAGCTCAAGCATGTTGAACAACGCACTGTCGATAAGTACCGCCGACAAGCAGAAAAGACTGGGAAGCAGTCCTTT
GCTCTGGCTTGGGTTATGGACCAGGGCAGTGAGGAACGGGACCGCGGCGTGACCATGGACATTGCGACAAACCAC
TTTGAGACGCCAATGACGCGTTTCACAATCCTCGATGCACCCGGTCATCGAGATTTCGTGCCCAATATGATTGCC
GGTGCCAGTCAGGCGGATCTGGCCATCCTAGTTGTCGATGCCAACACGGGTGCTTTCGAAAAGGGACTCAAGGGA
CAGACACGGGAGCACGTGCTTCTGCTGCGTAGCTTGGGCGTGCAACGGCTCATAGTGGCTGTAAACAAGCTAGAC
ATGGTGGCATGGTCCAAAGAGCGCTTTGAAGAAATTCGTGAGCAAGTCGGCGGTTTCCTGACGGGTCTTGGTTTC
CAAAGCAAACACGTGAGCTTCATACCAATATCGGGGCTGAATGGAGACAACGTGGCATTCAAGGTGAAAGATGCA
GCAGCGTCGTGGTACACAGGATCAACTCTGATGGAAGCACTGGAGGCGCCAGGGCCTTCGACTATGACAAAAATG
CTGGAAAAGTCCTTTCGGATGCCCATTTTAGAAGTATTTCGGTCACCGCAGCAAGGAACAACAACACTAGCTGGT
CGCATTGATGCAGGCACAGTTCAGGTTGGTGACGAAGTGCTTGTTCAACCTAGTGGAGAGGCCGCCTACGTTAAA
TCCATCATGGTCGACACGGAATCGCAAGATTGGGCCGTGGCCGGACAGAGTGTTAGCATCTCTCTGGCCAACATT
GATGCCGTCCATATTCGAGTGGGAGACATTGTATGTGACGCTAAACAGCCCATACTCTGCGGTGATTTTTTTACC
ATCAAGGCCATGGCGTTTGATCATGTGGTGCCTATGCCCGTGGATCTACACCGAGGACGTCTACACGTGGCCGGG
CAGATTGAGTCAATGGTGGCGCTGCTCGACAAGGCGACAGGCACCATCATCAAGAAGAAGCCACGAGTGGTGCAG
CCAGGGGGAGTGGCGCGCATGGTTATTCGTCTAAACACCAAGGTGCCTCTTGAGGCAGGCCAACGTGTCGTGATT
CGCAGTGGAGGAGAGACCATCGCAGCTGGCCTGCTCGAATAG
Transcript >OphauG2|550
ATGGCCGAAATCCTTGAGGACGACTTGATTGACTATCAAGACGATTATGACGATGACGAATTCAGCGCCGAGGAC
CACGAGGCAATGAAGACGGGCACTGCCGAGGTGCGGCTTGCACTGGGGCCCGACGCCTCCAAGGTGACGGTGACA
CAGATTCAAGACTCTCTATGGCATTACTACTATGATGTCGACAAGTCGGTTGCCTATCTGCGACGTACTTTCATT
TCTCCTGCGCCCAAGCCCGCTTCAAAACCAACTTCCAAATCGACCATCAAGCCTAACAATAAGTCGCCAGAGGGT
AAGTTGGACGATGCCCCCTTTCTCGAAGCTCTTAGCCTGTTTGTCCGGGCCGCTGGAGCACATCGTGGGTCGCCG
TCAGCGCCAGTACAGACTCGCCGGTGTCTGCCTACAGAGTTTGACGACATGCCTTGGTTGCATGTTCCGGAGCAT
CGAATAGCCCATCTCATTCCCCCTGTGCAACCCCAAGGCGGGCTGTTGGGTGGTGGCGATGGCTCTCCGCGCATG
TCAAAGCTACAAGCTCTTGCAGCTGCAAGGAAAAAAAAGCAGGATGAGAAGAAGGAGATGGACAGGACGATGCAG
ACCGAAGCTGGCATCAAGCGATTATCCATTTCGCACCATGTTCAAGAGTCAGAGGTATCCTCTCCCAAACGACAC
AAGGGTTCGGAAATGTTTTCTCCTCGGCCATCAATTTCATCTCCTACTACTCCAGCCTCGATGGAGCAGGCGCTC
CTACACGACCCTTCGCCACATGTAGACAGTGCCACGAGGTTGACTCCGTCTGCCTTGGCTCAAACGCTCTTCGAT
CCTACGCCAGCCCGCCTATTGAACAGGCCAGAATTCTTTGCCATGCCTTATGCATCTTCATGCGTCTTTTCCTGT
GCTGCTTTTTCCCAACCCAGCCCCGACGACGTTGTGCTCGCGGCCCAGGCGCAAGCGGGTAAGAAGGCACCGTCC
AAGACCAAAAAGTCGGAGGATAGAAACACGAGCAATGCCGGTGACAAGCAGGCGCAAGCAGTCGAGGGACTGTCA
ACACTCAAGATTAACGATTCAGCGCCCAAAACCAAGGGTCTCGATGTCATTCAAGAGTTTCAGAAAAGCAACAGC
AAACGGAGCACCAGCTTTGTTGTCGTTGGCCACGTGGATGCTGGCAAGAGTACGCTCATGGGTCGGCTATTACTC
GAGCTCAAGCATGTTGAACAACGCACTGTCGATAAGTACCGCCGACAAGCAGAAAAGACTGGGAAGCAGTCCTTT
GCTCTGGCTTGGGTTATGGACCAGGGCAGTGAGGAACGGGACCGCGGCGTGACCATGGACATTGCGACAAACCAC
TTTGAGACGCCAATGACGCGTTTCACAATCCTCGATGCACCCGGTCATCGAGATTTCGTGCCCAATATGATTGCC
GGTGCCAGTCAGGCGGATCTGGCCATCCTAGTTGTCGATGCCAACACGGGTGCTTTCGAAAAGGGACTCAAGGGA
CAGACACGGGAGCACGTGCTTCTGCTGCGTAGCTTGGGCGTGCAACGGCTCATAGTGGCTGTAAACAAGCTAGAC
ATGGTGGCATGGTCCAAAGAGCGCTTTGAAGAAATTCGTGAGCAAGTCGGCGGTTTCCTGACGGGTCTTGGTTTC
CAAAGCAAACACGTGAGCTTCATACCAATATCGGGGCTGAATGGAGACAACGTGGCATTCAAGGTGAAAGATGCA
GCAGCGTCGTGGTACACAGGATCAACTCTGATGGAAGCACTGGAGGCGCCAGGGCCTTCGACTATGACAAAAATG
CTGGAAAAGTCCTTTCGGATGCCCATTTTAGAAGTATTTCGGTCACCGCAGCAAGGAACAACAACACTAGCTGGT
CGCATTGATGCAGGCACAGTTCAGGTTGGTGACGAAGTGCTTGTTCAACCTAGTGGAGAGGCCGCCTACGTTAAA
TCCATCATGGTCGACACGGAATCGCAAGATTGGGCCGTGGCCGGACAGAGTGTTAGCATCTCTCTGGCCAACATT
GATGCCGTCCATATTCGAGTGGGAGACATTGTATGTGACGCTAAACAGCCCATACTCTGCGGTGATTTTTTTACC
ATCAAGGCCATGGCGTTTGATCATGTGGTGCCTATGCCCGTGGATCTACACCGAGGACGTCTACACGTGGCCGGG
CAGATTGAGTCAATGGTGGCGCTGCTCGACAAGGCGACAGGCACCATCATCAAGAAGAAGCCACGAGTGGTGCAG
CCAGGGGGAGTGGCGCGCATGGTTATTCGTCTAAACACCAAGGTGCCTCTTGAGGCAGGCCAACGTGTCGTGATT
CGCAGTGGAGGAGAGACCATCGCAGCTGGCCTGCTCGAATAG
Gene >OphauG2|550
ATGGCCGAAATCCTTGAGGACGACTTGATTGACTATCAAGACGATTATGACGATGACGAATTCAGCGCCGAGGAC
CACGAGGCAATGAAGACGGGCACTGCCGAGGTGCGGCTTGCACTGGGGCCCGACGCCTCCAAGGTGACGGTGACA
CAGATTCAAGACTCTCTATGGCATTACTACTATGATGTCGACAAGTCGGTTGCCTATCTGCGACGTACTTTCATT
TCTCCTGCGCCCAAGCCCGCTTCAAAACCAACTTCCAAATCGACCATCAAGCCTAACAATAAGTCGCCAGAGGGT
AAGTTGGACGATGCCCCCTTTCTCGAAGCTCTTAGCCTGTTTGTCCGGGCCGCTGGAGCACATCGTGGGTCGCCG
TCAGCGCCAGTACAGACTCGCCGGTGTCTGCCTACAGAGTTTGACGACATGCCTTGGTTGCATGTTCCGGAGCAT
CGAATAGCCCATCTCATTCCCCCTGTGCAACCCCAAGGCGGGCTGTTGGGTGGTGGCGATGGCTCTCCGCGCATG
TCAAAGCTACAAGCTCTTGCAGCTGCAAGGAAAAAAAAGCAGGATGAGAAGAAGGAGATGGACAGGACGATGCAG
ACCGAAGCTGGCATCAAGCGATTATCCATTTCGCACCATGTTCAAGAGTCAGAGGTATCCTCTCCCAAACGACAC
AAGGGTTCGGAAATGTTTTCTCCTCGGCCATCAATTTCATCTCCTACTACTCCAGCCTCGATGGAGCAGGCGCTC
CTACACGACCCTTCGCCACATGTAGACAGTGCCACGAGGTTGACTCCGTCTGCCTTGGCTCAAACGCTCTTCGAT
CCTACGCCAGCCCGCCTATTGAACAGGCCAGAATTCTTTGCCATGCCTTATGCATCTTCATGCGTCTTTTCCTGT
GCTGCTTTTTCCCAACCCAGCCCCGACGACGTTGTGCTCGCGGCCCAGGCGCAAGGTTCGAATTTCGGCAAGGCA
AGATAATGACTAATACTAATACCTGCCCAGCGGGTAAGAAGGCACCGTCCAAGACCAAAAAGTCGGAGGATAGAA
ACACGAGCAATGCCGGTGACAAGCAGGCGCAAGCAGTCGAGGGACTGTCAACACTCAAGATTAACGATTCAGCGC
CCAAAACCAAGGGTCTCGATGTCATTCAAGAGTTTCAGAAAAGCAACAGCAAACGGAGCACCAGCTTTGTTGTCG
TTGGTAAGTTAATGGCAAAGTGAGAGGCCAGATGCAGCTGACAATGATAGGCCACGTGGATGCTGGCAAGAGTAC
GCTCATGGGTCGGCTATTACTCGAGCTCAAGCATGTTGAACAACGCACTGTCGATAAGTACCGCCGACAAGCAGA
AAAGACTGGGAAGCAGTCCTTTGCTCTGGCTTGGGTTATGGACCAGGGCAGTGAGGAACGGGACCGCGGCGTGAC
CATGGACATTGCGACAAACCACTTTGAGACGCCAATGACGCGTTTCACAATCCTCGATGCACCCGGTCATCGAGA
TTTCGTGCCCAATATGATTGCCGGTGCCAGTCAGGCGGATCTGGCCATCCTAGTTGTCGATGCCAACACGGGTGC
TTTCGAAAAGGGACTCAAGGGACAGACACGGGAGCACGTGCTTCTGCTGCGTAGCTTGGGCGTGCAACGGCTCAT
AGTGGCTGTAAACAAGCTAGACATGGTGGCATGGTCCAAAGAGCGCTTTGAAGAAATTCGTGAGCAAGTCGGCGG
TTTCCTGACGGGTCTTGGTTTCCAAAGCAAACACGTGAGCTTCATACCAATATCGGGGCTGAATGGAGACAACGT
GGCATTCAAGGTGAAAGATGCAGCAGCGTCGTGGTACACAGGATCAACTCTGATGGAAGCACTGGAGGCGCCAGG
GCCTTCGACTATGACAAAAATGCTGGAAAAGTCCTTTCGGATGCCCATTTTAGAAGTATTTCGGTCACCGCAGCA
AGGAACAACAACACTAGCTGGTCGCATTGATGCAGGCACAGTTCAGGTTGGTGACGAAGTGCTTGTTCAACCTAG
TGGAGAGGCCGCCTACGTTAAATCCATCATGGTCGACACGGAATCGCAAGATTGGGCCGTGGCCGGACAGAGTGT
TAGCATCTCTCTGGCCAACATTGATGCCGTCCATATTCGAGTGGGAGACATTGTATGTGACGCTAAACAGCCCAT
ACTCTGCGGTGATTTTTTTACCATCAAGGCCATGGCGTTTGATCATGTGGTGCCTATGCCCGTGGATCTACACCG
AGGACGTCTACACGTGGCCGGGCAGATTGAGTCAATGGTGGCGCTGCTCGACAAGGCGACAGGCACCATCATCAA
GAAGAAGCCACGAGTGGTGCAGCCAGGGGGAGTGGCGCGCATGGTTATTCGTCTAAACACCAAGGTGCCTCTTGA
GGCAGGCCAACGTGTCGTGATTCGCAGTGGAGGAGAGACCATCGCAGCTGGCCTGCTCGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail