Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|55
Gene name
LocationContig_10:22359..25358
Strand-
Gene length (bp)2999
Transcript length (bp)2622
Coding sequence length (bp)2622
Protein length (aa) 874

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03835 Rad4 Rad4 transglutaminase-like domain 1.7E-27 333 496
PF10405 BHD_3 Rad4 beta-hairpin domain 3 3.3E-26 638 708
PF10403 BHD_1 Rad4 beta-hairpin domain 1 1.0E-20 508 565
PF10404 BHD_2 Rad4 beta-hairpin domain 2 1.6E-15 569 631

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87235|RHP42_SCHPO DNA repair protein rhp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp42 PE=3 SV=1 202 753 6.0E-86
sp|Q10445|RHP41_SCHPO DNA repair protein rhp41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp41 PE=3 SV=1 214 753 4.0E-47
sp|Q24595|XPC_DROME DNA repair protein complementing XP-C cells homolog OS=Drosophila melanogaster GN=Xpc PE=1 SV=2 355 753 2.0E-37
sp|Q01831|XPC_HUMAN DNA repair protein complementing XP-C cells OS=Homo sapiens GN=XPC PE=1 SV=4 366 815 5.0E-30
sp|P14736|RAD4_YEAST DNA repair protein RAD4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD4 PE=1 SV=3 205 784 7.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87235|RHP42_SCHPO DNA repair protein rhp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp42 PE=3 SV=1 202 753 6.0E-86
sp|Q10445|RHP41_SCHPO DNA repair protein rhp41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp41 PE=3 SV=1 214 753 4.0E-47
sp|Q24595|XPC_DROME DNA repair protein complementing XP-C cells homolog OS=Drosophila melanogaster GN=Xpc PE=1 SV=2 355 753 2.0E-37
sp|Q01831|XPC_HUMAN DNA repair protein complementing XP-C cells OS=Homo sapiens GN=XPC PE=1 SV=4 366 815 5.0E-30
sp|P14736|RAD4_YEAST DNA repair protein RAD4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD4 PE=1 SV=3 205 784 7.0E-30
sp|P51612|XPC_MOUSE DNA repair protein complementing XP-C cells homolog OS=Mus musculus GN=Xpc PE=1 SV=2 366 753 3.0E-28
sp|Q8W489|RAD4_ARATH DNA repair protein RAD4 OS=Arabidopsis thaliana GN=RAD4 PE=1 SV=1 360 754 2.0E-21
sp|Q06665|RAD34_YEAST DNA repair protein RAD34 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD34 PE=1 SV=1 518 755 3.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3560
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|55 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5918
Ophiocordyceps camponoti-floridani Ophcf2|03086
Ophiocordyceps camponoti-rufipedis Ophun1|2042
Ophiocordyceps kimflemingae Ophio5|1537
Ophiocordyceps subramaniannii Hirsu2|6836

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|55
MPPIVPRKRLPTLHDELDAVATPHSRQSASVAPGTCQGGSDSSLTSLSDEEFEDVVDPKRQKVKQRASNDSEDDE
DDDDDIEFEDVAAPEQQAIDAPVTSGDLELTLDKNPQFSYVASLGDKRGAIMISHLTPTLWDEVDRWRRNSGLET
PPSPPKPLNRARTRGQHKISGEKGLNKLDSDREGRDWDKSAKKLETCHVDMSHGDPLFRLMQYLVPWWKQRFRIT
APGLRKRGYMPMERLDRLIKAHKTEFDDAQRFGERIPNIEAFRKHAQDCQGSRDVGSQLFTALLRGLGLEARLAI
KPTKDETARKTRNRNKSSSSNASQKNLQPDFADTDDESIVEMDLSPKEVQTATRRFDLDLEYPHYWTEVLSPVTN
KYLPVESIVKGVVATNKDLVESLAPRGLKADKARQILAYVVGHSPDGTAKDLTIRYLKKQVFPGRTKGARMPMER
IPIYNHNGKVKRYEQIDWFKSVMAGYVRGTEKHPLTEADELEDSTDLTPAKPEKKEVKEGQETLQYYKQSKEFVL
ERHLKREEALKPGASPVKIFKNKSKGGKLEDEDVYLRTDVLQVKSAETWHKQGRAPLPGEQPLKRVPYRAATLNR
RREILEAEAATGEKVLQGLYSHGQTDWIIPPPIKNGVIPKNEYGNIDLFAEHMCPKGAVHIPYRGAVRVCKRLQI
DYAEAVVDFEFGHRMAVPVIRGVVIAEEYHDQLIIELEKDEAERARKEDEKRRKTVLGRWRKFIMGLRIVERIRQ
DYGDIDEGVLELGHAKKRDAAPESDVDMGGGFLPEGYEEEEEEERKKEETHATASFFPTGGSDDENSDGGLIMEV
EDARHAPEVADPNMAQGTQEETRKERVKGTKARGESKRTGMRTRSQRK*
Coding >OphauG2|55
ATGCCTCCGATTGTGCCACGCAAACGCTTGCCGACCTTGCATGATGAGCTAGACGCTGTGGCGACGCCTCACTCT
CGACAATCCGCATCAGTTGCACCGGGTACCTGTCAAGGAGGAAGTGATAGCTCACTGACATCGCTTTCTGATGAG
GAATTCGAGGATGTGGTTGATCCGAAGCGACAGAAAGTCAAACAGCGCGCAAGTAACGACAGCGAAGACGACGAA
GACGACGACGACGATATTGAGTTTGAAGATGTCGCCGCACCGGAACAGCAAGCCATTGATGCACCTGTGACTTCT
GGAGATCTGGAACTCACACTAGACAAGAACCCCCAATTTTCGTACGTGGCGTCGCTCGGGGACAAGAGAGGCGCT
ATAATGATATCACACCTTACACCAACATTATGGGACGAGGTTGACCGTTGGCGGCGCAATTCGGGACTCGAGACG
CCGCCCTCACCGCCCAAGCCACTCAACAGGGCCCGAACCAGAGGACAACACAAAATATCAGGCGAGAAAGGACTG
AACAAGTTGGATTCCGATAGAGAGGGCCGCGATTGGGACAAGTCTGCCAAGAAGCTCGAAACTTGTCACGTTGAT
ATGAGCCACGGAGATCCCTTGTTCAGGCTCATGCAATATCTCGTGCCGTGGTGGAAGCAACGCTTTCGAATTACT
GCCCCTGGTTTGCGCAAACGAGGCTACATGCCCATGGAACGCCTCGACAGACTCATTAAAGCCCATAAGACCGAG
TTTGATGATGCTCAGAGATTTGGCGAACGTATTCCCAATATTGAAGCATTCCGCAAACACGCCCAAGACTGCCAA
GGTAGCCGGGATGTTGGGTCACAGCTTTTCACGGCCCTTCTCCGGGGACTTGGCCTCGAGGCTCGGCTGGCTATC
AAGCCGACGAAAGACGAAACGGCGCGCAAAACCCGCAATCGGAACAAGTCCAGCTCATCCAATGCCAGTCAGAAA
AACCTGCAACCAGACTTTGCAGATACTGATGATGAATCGATAGTGGAGATGGACCTTAGTCCTAAAGAGGTACAA
ACTGCGACGAGGAGGTTCGATCTAGATCTCGAGTATCCTCACTACTGGACTGAAGTCCTATCTCCGGTCACAAAC
AAGTACTTGCCCGTTGAATCGATAGTCAAGGGCGTGGTTGCGACAAATAAAGACTTGGTGGAATCACTGGCGCCC
CGCGGCTTGAAGGCGGATAAAGCAAGACAGATTTTGGCCTATGTAGTTGGGCACTCTCCAGACGGCACAGCAAAG
GACTTGACCATCAGATATCTCAAAAAGCAAGTGTTTCCTGGACGAACCAAAGGCGCGCGAATGCCTATGGAGAGA
ATCCCCATATATAATCACAACGGGAAAGTGAAGCGCTACGAGCAGATTGATTGGTTTAAATCAGTCATGGCCGGA
TACGTTCGTGGCACGGAAAAACATCCTCTCACTGAAGCAGACGAGCTGGAAGACTCAACGGATCTCACGCCGGCG
AAGCCAGAGAAGAAGGAGGTCAAGGAAGGACAGGAAACTCTCCAGTACTACAAACAGTCCAAGGAATTCGTCCTA
GAGAGACATTTGAAGCGTGAAGAGGCGTTGAAACCAGGCGCTTCTCCCGTCAAGATTTTTAAAAATAAGAGCAAA
GGTGGCAAGCTGGAAGACGAAGACGTCTACCTTCGCACAGATGTACTTCAAGTCAAAAGTGCTGAAACGTGGCAC
AAACAAGGCAGAGCACCGTTACCTGGAGAACAGCCCCTCAAGCGCGTCCCGTATCGCGCTGCTACACTCAACAGA
CGGAGAGAGATTCTTGAGGCCGAGGCGGCGACGGGAGAAAAAGTGCTCCAAGGCCTCTATAGCCATGGGCAAACG
GACTGGATTATTCCACCGCCCATTAAAAACGGTGTGATTCCCAAGAACGAATATGGAAACATTGATTTATTCGCG
GAACACATGTGCCCAAAAGGCGCAGTGCACATACCATACCGAGGGGCCGTACGCGTATGCAAGCGGCTGCAGATT
GATTACGCCGAAGCAGTTGTGGATTTTGAATTTGGGCACAGGATGGCGGTTCCAGTCATCCGAGGCGTCGTTATT
GCCGAAGAATACCATGACCAGCTTATAATTGAGCTTGAGAAGGACGAAGCGGAGAGGGCACGAAAGGAGGACGAG
AAGCGGCGCAAGACGGTTCTCGGCCGTTGGCGCAAGTTTATCATGGGGCTTCGCATCGTGGAAAGAATTCGTCAA
GACTACGGCGATATCGATGAAGGTGTGCTCGAGCTCGGACATGCAAAAAAAAGAGATGCAGCGCCAGAGTCTGAT
GTAGACATGGGCGGAGGTTTCTTGCCTGAAGGGTACGAAGAAGAAGAAGAAGAAGAAAGAAAAAAAGAAGAGACG
CATGCTACAGCGAGCTTCTTTCCCACTGGTGGTAGCGACGACGAAAATAGCGACGGAGGACTCATCATGGAGGTA
GAAGATGCCAGGCACGCACCCGAGGTAGCCGATCCAAACATGGCACAAGGAACACAGGAGGAGACTAGGAAGGAG
AGGGTAAAGGGTACAAAAGCTAGAGGAGAGTCCAAGCGGACGGGAATGCGTACTCGAAGTCAGCGCAAATGA
Transcript >OphauG2|55
ATGCCTCCGATTGTGCCACGCAAACGCTTGCCGACCTTGCATGATGAGCTAGACGCTGTGGCGACGCCTCACTCT
CGACAATCCGCATCAGTTGCACCGGGTACCTGTCAAGGAGGAAGTGATAGCTCACTGACATCGCTTTCTGATGAG
GAATTCGAGGATGTGGTTGATCCGAAGCGACAGAAAGTCAAACAGCGCGCAAGTAACGACAGCGAAGACGACGAA
GACGACGACGACGATATTGAGTTTGAAGATGTCGCCGCACCGGAACAGCAAGCCATTGATGCACCTGTGACTTCT
GGAGATCTGGAACTCACACTAGACAAGAACCCCCAATTTTCGTACGTGGCGTCGCTCGGGGACAAGAGAGGCGCT
ATAATGATATCACACCTTACACCAACATTATGGGACGAGGTTGACCGTTGGCGGCGCAATTCGGGACTCGAGACG
CCGCCCTCACCGCCCAAGCCACTCAACAGGGCCCGAACCAGAGGACAACACAAAATATCAGGCGAGAAAGGACTG
AACAAGTTGGATTCCGATAGAGAGGGCCGCGATTGGGACAAGTCTGCCAAGAAGCTCGAAACTTGTCACGTTGAT
ATGAGCCACGGAGATCCCTTGTTCAGGCTCATGCAATATCTCGTGCCGTGGTGGAAGCAACGCTTTCGAATTACT
GCCCCTGGTTTGCGCAAACGAGGCTACATGCCCATGGAACGCCTCGACAGACTCATTAAAGCCCATAAGACCGAG
TTTGATGATGCTCAGAGATTTGGCGAACGTATTCCCAATATTGAAGCATTCCGCAAACACGCCCAAGACTGCCAA
GGTAGCCGGGATGTTGGGTCACAGCTTTTCACGGCCCTTCTCCGGGGACTTGGCCTCGAGGCTCGGCTGGCTATC
AAGCCGACGAAAGACGAAACGGCGCGCAAAACCCGCAATCGGAACAAGTCCAGCTCATCCAATGCCAGTCAGAAA
AACCTGCAACCAGACTTTGCAGATACTGATGATGAATCGATAGTGGAGATGGACCTTAGTCCTAAAGAGGTACAA
ACTGCGACGAGGAGGTTCGATCTAGATCTCGAGTATCCTCACTACTGGACTGAAGTCCTATCTCCGGTCACAAAC
AAGTACTTGCCCGTTGAATCGATAGTCAAGGGCGTGGTTGCGACAAATAAAGACTTGGTGGAATCACTGGCGCCC
CGCGGCTTGAAGGCGGATAAAGCAAGACAGATTTTGGCCTATGTAGTTGGGCACTCTCCAGACGGCACAGCAAAG
GACTTGACCATCAGATATCTCAAAAAGCAAGTGTTTCCTGGACGAACCAAAGGCGCGCGAATGCCTATGGAGAGA
ATCCCCATATATAATCACAACGGGAAAGTGAAGCGCTACGAGCAGATTGATTGGTTTAAATCAGTCATGGCCGGA
TACGTTCGTGGCACGGAAAAACATCCTCTCACTGAAGCAGACGAGCTGGAAGACTCAACGGATCTCACGCCGGCG
AAGCCAGAGAAGAAGGAGGTCAAGGAAGGACAGGAAACTCTCCAGTACTACAAACAGTCCAAGGAATTCGTCCTA
GAGAGACATTTGAAGCGTGAAGAGGCGTTGAAACCAGGCGCTTCTCCCGTCAAGATTTTTAAAAATAAGAGCAAA
GGTGGCAAGCTGGAAGACGAAGACGTCTACCTTCGCACAGATGTACTTCAAGTCAAAAGTGCTGAAACGTGGCAC
AAACAAGGCAGAGCACCGTTACCTGGAGAACAGCCCCTCAAGCGCGTCCCGTATCGCGCTGCTACACTCAACAGA
CGGAGAGAGATTCTTGAGGCCGAGGCGGCGACGGGAGAAAAAGTGCTCCAAGGCCTCTATAGCCATGGGCAAACG
GACTGGATTATTCCACCGCCCATTAAAAACGGTGTGATTCCCAAGAACGAATATGGAAACATTGATTTATTCGCG
GAACACATGTGCCCAAAAGGCGCAGTGCACATACCATACCGAGGGGCCGTACGCGTATGCAAGCGGCTGCAGATT
GATTACGCCGAAGCAGTTGTGGATTTTGAATTTGGGCACAGGATGGCGGTTCCAGTCATCCGAGGCGTCGTTATT
GCCGAAGAATACCATGACCAGCTTATAATTGAGCTTGAGAAGGACGAAGCGGAGAGGGCACGAAAGGAGGACGAG
AAGCGGCGCAAGACGGTTCTCGGCCGTTGGCGCAAGTTTATCATGGGGCTTCGCATCGTGGAAAGAATTCGTCAA
GACTACGGCGATATCGATGAAGGTGTGCTCGAGCTCGGACATGCAAAAAAAAGAGATGCAGCGCCAGAGTCTGAT
GTAGACATGGGCGGAGGTTTCTTGCCTGAAGGGTACGAAGAAGAAGAAGAAGAAGAAAGAAAAAAAGAAGAGACG
CATGCTACAGCGAGCTTCTTTCCCACTGGTGGTAGCGACGACGAAAATAGCGACGGAGGACTCATCATGGAGGTA
GAAGATGCCAGGCACGCACCCGAGGTAGCCGATCCAAACATGGCACAAGGAACACAGGAGGAGACTAGGAAGGAG
AGGGTAAAGGGTACAAAAGCTAGAGGAGAGTCCAAGCGGACGGGAATGCGTACTCGAAGTCAGCGCAAATGA
Gene >OphauG2|55
ATGCCTCCGATTGTGCCACGCAAACGCTTGCGTAGCATATCGCCTCCCGAAGCCAAGAGAAAACAACAAACCTTA
AAGTCTAACAAACGGAAAGCGACCTTGCATGATGAGCTAGACGCTGTGGCGACGCCTCACTCTCGACAATCCGCA
TCAGTTGCACCGGGTACCTGTCAAGGAGGAAGTGATAGCTCACTGACATCGCTTTCTGATGAGGAATTCGAGGAT
GTGGTTGATCCGAAGCGACAGAAAGTCAAACAGCGCGCAAGTAACGACAGCGAAGACGACGAAGACGACGACGAC
GATATTGAGTTTGAAGATGTCGCCGCACCGGAACAGCAAGCCATTGATGCACCTGTGACTTCTGGAGATCTGGAA
CTCACACTAGACAAGAACCCCCAATTTTCGTACGTGGCGTCGCTCGGGGACAAGAGAGGCGTTACAAAGCGGGAA
AAAAAAGTCCGCATCGCAACTCATTGCTTACACGTCATGTTGCTTCTTTGGCACAATGCAATCCGGAATTCATGG
ATTTGCGACCAAGACGTCCAGGCTATAATGATATCACACCTTACACCAACATTATGGGACGAGGTTGACCGTTGG
CGGCGCAATTCGGGACTCGAGACGCCGCCCTCACCGCCCAAGCCACTCAACAGGGCCCGAACCAGAGGACAACAC
AAAATATCAGGCGAGAAAGGACTGAACAAGTTGGATTCCGATAGAGAGGGCCGCGATTGGGACAAGTCTGCCAAG
AAGCTCGAAACTTGTCACGTTGATATGAGCCACGGAGATCCCTTGTTCAGGCTCATGCAATATCTCGTGCCGTGG
TGGAAGCAACGCTTTCGAATTACTGCCCCTGGTTTGCGCAAACGAGGCTACATGCCCATGGAACGCCTCGACAGA
CTCATTAAAGCCCATAAGACCGAGTTTGATGATGCTCAGAGATTTGGCGAACGTATTCCCAATATTGAAGCATTC
CGCAAACACGCCCAAGACTGCCAAGGTAGCCGGGATGTTGGGTCACAGCTTTTCACGGCCCTTCTCCGGGGACTT
GGCCTCGAGGCTCGGCTGGTAAGTAATTTGCAATGCTTGGGATTTGGTTGGAACAAGTTTGAAGATGCAGAGCCT
GAAGAGGTGGATAAAGATGAAATTTCTAGAGCAACAGGAACCCAAGATAGGCAAAATCAATGCAAGTCTGGGCAC
AAAAAGGCTATCAAGCCGACGAAAGACGAAACGGCGCGCAAAACCCGCAATCGGAACAAGTCCAGCTCATCCAAT
GCCAGTCAGAAAAACCTGCAACCAGACTTTGCAGATACTGATGATGAATCGATAGTGGAGATGGACCTTAGTCCT
AAAGAGGTACAAACTGCGACGAGGAGGTTCGATCTAGATCTCGAGTATCCTCACTACTGGACTGAAGTCCTATCT
CCGGTCACAAACAAGTACTTGCCCGTTGAATCGATAGTCAAGGGCGTGGTTGCGACAAATAAAGACTTGGTGGAA
TCACTGGCGCCCCGCGGCTTGAAGGCGGATAAAGCAAGACAGATTTTGGCCTATGTAGTTGGGCACTCTCCAGAC
GGCACAGCAAAGGACTTGACCATCAGATATCTCAAAAAGCAAGTGTTTCCTGGACGAACCAAAGGCGCGCGAATG
CCTATGGAGAGAATCCCCATATATAATCACAACGGGAAAGTGAAGCGCTACGAGCAGATTGATTGGTTTAAATCA
GTCATGGCCGGATACGTTCGTGGCACGGAAAAACATCCTCTCACTGAAGCAGACGAGCTGGAAGACTCAACGGAT
CTCACGCCGGCGAAGCCAGAGAAGAAGGAGGTCAAGGAAGGACAGGAAACTCTCCAGTACTACAAACAGTCCAAG
GAATTCGTCCTAGAGAGACATTTGAAGCGTGAAGAGGCGTTGAAACCAGGCGCTTCTCCCGTCAAGATTTTTAAA
AATAAGAGCAAAGGTGGCAAGCTGGAAGACGAAGACGTCTACCTTCGCACAGATGTACTTCAAGTCAAAAGTGCT
GAAACGTGGCACAAACAAGGCAGAGCACCGTTACCTGGAGAACAGCCCCTCAAGCGCGTCCCGTATCGCGCTGCT
ACACTCAACAGACGGAGAGAGATTCTTGAGGCCGAGGCGGCGACGGGAGAAAAAGTGCTCCAAGGCCTCTATAGC
CATGGGCAAACGGACTGGATTATTCCACCGCCCATTAAAAACGGTGTGATTCCCAAGAACGAATATGGGTACGTT
GCAGCAGGCCCAGGCCCGAACCGACTGGTATCTGTACCATGCTGACGACCGAGGCCAGAAACATTGATTTATTCG
CGGAACACATGTGCCCAAAAGGCGCAGTGCACATACCATACCGAGGGGCCGTACGCGTATGCAAGCGGCTGCAGA
TTGATTACGCCGAAGCAGTTGTGGATTTTGAATTTGGGCACAGGATGGCGGTTCCAGTCATCCGAGGCGTCGTTA
TTGCCGAAGAATACCATGACCAGCTTATAATTGAGCTTGAGAAGGACGAAGCGGAGAGGGCACGAAAGGAGGACG
AGAAGCGGCGCAAGACGGTTCTCGGCCGTTGGCGCAAGTTTATCATGGGGCTTCGCATCGTGGAAAGAATTCGTC
AAGACTACGGCGATATCGATGAAGGTGTGCTCGAGCTCGGACATGCAAAAAAAAGAGATGCAGCGCCAGAGTCTG
ATGTAGACATGGGCGGAGGTTTCTTGCCTGAAGGGTACGAAGAAGAAGAAGAAGAAGAAAGAAAAAAAGAAGAGA
CGCATGCTACAGCGAGCTTCTTTCCCACTGGTGGTAGCGACGACGAAAATAGCGACGGAGGACTCATCATGGAGG
TAGAAGATGCCAGGCACGCACCCGAGGTAGCCGATCCAAACATGGCACAAGGAACACAGGAGGAGACTAGGAAGG
AGAGGGTAAAGGGTACAAAAGCTAGAGGAGAGTCCAAGCGGACGGGAATGCGTACTCGAAGTCAGCGCAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail