Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5492
Gene name
LocationContig_507:5588..8359
Strand+
Gene length (bp)2771
Transcript length (bp)2523
Coding sequence length (bp)2523
Protein length (aa) 841

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11957 efThoc1 THO complex subunit 1 transcription elongation factor 7.2E-130 108 602
PF00625 Guanylate_kin Guanylate kinase 4.1E-25 614 795

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q93VM9|THOC1_ARATH THO complex subunit 1 OS=Arabidopsis thaliana GN=THO1 PE=1 SV=1 111 593 5.0E-48
sp|Q9URT2|YJU3_SCHPO Uncharacterized protein P25A2.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCP25A2.03 PE=1 SV=1 108 574 4.0E-44
sp|Q96FV9|THOC1_HUMAN THO complex subunit 1 OS=Homo sapiens GN=THOC1 PE=1 SV=1 91 568 2.0E-40
sp|Q8R3N6|THOC1_MOUSE THO complex subunit 1 OS=Mus musculus GN=Thoc1 PE=1 SV=1 124 568 8.0E-39
sp|Q72DM9|KGUA_DESVH Guanylate kinase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=gmk PE=3 SV=1 617 791 2.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q93VM9|THOC1_ARATH THO complex subunit 1 OS=Arabidopsis thaliana GN=THO1 PE=1 SV=1 111 593 5.0E-48
sp|Q9URT2|YJU3_SCHPO Uncharacterized protein P25A2.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCP25A2.03 PE=1 SV=1 108 574 4.0E-44
sp|Q96FV9|THOC1_HUMAN THO complex subunit 1 OS=Homo sapiens GN=THOC1 PE=1 SV=1 91 568 2.0E-40
sp|Q8R3N6|THOC1_MOUSE THO complex subunit 1 OS=Mus musculus GN=Thoc1 PE=1 SV=1 124 568 8.0E-39
sp|Q72DM9|KGUA_DESVH Guanylate kinase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=gmk PE=3 SV=1 617 791 2.0E-17
sp|Q9P6I5|KGUA_SCHPO Guanylate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1198.05 PE=3 SV=1 615 791 4.0E-17
sp|Q2QPW1|GMK1_ORYSJ Guanylate kinase 1 OS=Oryza sativa subsp. japonica GN=GK1 PE=2 SV=2 612 791 8.0E-17
sp|P15454|KGUA_YEAST Guanylate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUK1 PE=1 SV=2 616 796 9.0E-17
sp|Q9JLB2|MPP5_MOUSE MAGUK p55 subfamily member 5 OS=Mus musculus GN=Mpp5 PE=1 SV=1 595 791 1.0E-16
sp|Q8N3R9|MPP5_HUMAN MAGUK p55 subfamily member 5 OS=Homo sapiens GN=MPP5 PE=1 SV=3 595 791 1.0E-16
sp|Q5RDQ2|MPP5_PONAB MAGUK p55 subfamily member 5 OS=Pongo abelii GN=MPP5 PE=2 SV=1 595 791 1.0E-16
sp|Q54XF2|KGUA_DICDI Guanylate kinase OS=Dictyostelium discoideum GN=guk1 PE=3 SV=1 616 807 7.0E-16
sp|Q9JT96|KGUA_NEIMA Guanylate kinase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gmk PE=3 SV=1 618 795 8.0E-15
sp|Q64520|KGUA_MOUSE Guanylate kinase OS=Mus musculus GN=Guk1 PE=1 SV=2 616 793 9.0E-15
sp|Q16774|KGUA_HUMAN Guanylate kinase OS=Homo sapiens GN=GUK1 PE=1 SV=2 616 793 1.0E-14
sp|Q9JYB5|KGUA_NEIMB Guanylate kinase OS=Neisseria meningitidis serogroup B (strain MC58) GN=gmk PE=3 SV=1 618 795 2.0E-14
sp|Q5F775|KGUA_NEIG1 Guanylate kinase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=gmk PE=3 SV=1 618 787 7.0E-14
sp|Q9M682|GMK2_ARATH Guanylate kinase 2 OS=Arabidopsis thaliana GN=GK-2 PE=2 SV=1 615 791 8.0E-14
sp|Q6P7F1|MPP4_MOUSE MAGUK p55 subfamily member 4 OS=Mus musculus GN=Mpp4 PE=1 SV=1 617 791 1.0E-13
sp|Q2A2K6|KGUA_FRATH Guanylate kinase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=gmk PE=3 SV=1 613 794 1.0E-13
sp|P72648|KGUA_SYNY3 Guanylate kinase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gmk PE=3 SV=1 617 795 1.0E-13
sp|P31006|KGUA_PIG Guanylate kinase OS=Sus scrofa GN=GUK1 PE=1 SV=2 616 793 3.0E-13
sp|Q9QYH1|MPP4_RAT MAGUK p55 subfamily member 4 OS=Rattus norvegicus GN=Mpp4 PE=1 SV=1 605 792 3.0E-13
sp|P46195|KGUA_BOVIN Guanylate kinase OS=Bos taurus GN=GUK1 PE=1 SV=2 616 793 4.0E-13
sp|Q5NEY6|KGUA_FRATT Guanylate kinase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=gmk PE=3 SV=1 613 794 4.0E-13
sp|Q14GD9|KGUA_FRAT1 Guanylate kinase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=gmk PE=3 SV=1 613 794 4.0E-13
sp|Q8UGD7|KGUA_AGRFC Guanylate kinase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=gmk PE=3 SV=1 610 814 5.0E-13
sp|Q0BL54|KGUA_FRATO Guanylate kinase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=gmk PE=3 SV=1 613 794 6.0E-13
sp|Q9Z961|KGUA_CHLPN Guanylate kinase OS=Chlamydia pneumoniae GN=gmk PE=3 SV=1 625 791 1.0E-12
sp|Q7WZE5|KGUA_SHEVD Guanylate kinase OS=Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12) GN=gmk PE=3 SV=1 618 787 2.0E-12
sp|Q1QSI1|KGUA_CHRSD Guanylate kinase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=gmk PE=3 SV=1 609 800 3.0E-12
sp|Q3IJH8|KGUA_PSEHT Guanylate kinase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=gmk PE=3 SV=1 618 810 4.0E-12
sp|Q1WUB5|KGUA_LACS1 Guanylate kinase OS=Lactobacillus salivarius (strain UCC118) GN=gmk PE=3 SV=1 617 795 4.0E-12
sp|P60552|KGUA_LACJO Guanylate kinase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=gmk PE=3 SV=1 617 809 5.0E-12
sp|Q088T7|KGUA_SHEFN Guanylate kinase OS=Shewanella frigidimarina (strain NCIMB 400) GN=gmk PE=3 SV=1 618 795 7.0E-12
sp|Q7U570|KGUA_SYNPX Guanylate kinase OS=Synechococcus sp. (strain WH8102) GN=gmk PE=3 SV=1 618 787 1.0E-11
sp|Q9KX62|KGUA_MYCGA Guanylate kinase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=gmk PE=3 SV=2 617 795 2.0E-11
sp|Q1MRL0|KGUA_LAWIP Guanylate kinase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=gmk PE=3 SV=1 617 791 2.0E-11
sp|Q1MJ02|KGUA_RHIL3 Guanylate kinase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=gmk PE=3 SV=1 617 814 2.0E-11
sp|P93757|GMK1_ARATH Guanylate kinase 1 OS=Arabidopsis thaliana GN=GK-1 PE=1 SV=3 615 791 2.0E-11
sp|Q0HE40|KGUA_SHESM Guanylate kinase OS=Shewanella sp. (strain MR-4) GN=gmk PE=3 SV=1 618 787 3.0E-11
sp|Q0HZX1|KGUA_SHESR Guanylate kinase OS=Shewanella sp. (strain MR-7) GN=gmk PE=3 SV=2 618 791 3.0E-11
sp|Q8JHF4|MPP5A_DANRE MAGUK p55 subfamily member 5-A OS=Danio rerio GN=mpp5a PE=1 SV=2 611 791 3.0E-11
sp|Q8DMQ7|KGUA_THEEB Guanylate kinase OS=Thermosynechococcus elongatus (strain BP-1) GN=gmk PE=3 SV=1 610 796 3.0E-11
sp|Q2KA85|KGUA_RHIEC Guanylate kinase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=gmk PE=3 SV=1 617 814 6.0E-11
sp|Q8XD88|KGUA_ECO57 Guanylate kinase OS=Escherichia coli O157:H7 GN=gmk PE=3 SV=1 618 804 9.0E-11
sp|Q1LQ34|KGUA_CUPMC Guanylate kinase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=gmk PE=3 SV=1 618 807 9.0E-11
sp|Q3YW11|KGUA_SHISS Guanylate kinase OS=Shigella sonnei (strain Ss046) GN=gmk PE=3 SV=1 618 804 1.0E-10
sp|P60548|KGUA_SHIFL Guanylate kinase OS=Shigella flexneri GN=gmk PE=3 SV=1 618 804 1.0E-10
sp|Q1R4U3|KGUA_ECOUT Guanylate kinase OS=Escherichia coli (strain UTI89 / UPEC) GN=gmk PE=3 SV=2 618 804 1.0E-10
sp|P60546|KGUA_ECOLI Guanylate kinase OS=Escherichia coli (strain K12) GN=gmk PE=1 SV=1 618 804 1.0E-10
sp|P60547|KGUA_ECOL6 Guanylate kinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gmk PE=3 SV=1 618 804 1.0E-10
sp|Q0TBG1|KGUA_ECOL5 Guanylate kinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=gmk PE=3 SV=1 618 804 1.0E-10
sp|Q0SS73|KGUA_CLOPS Guanylate kinase OS=Clostridium perfringens (strain SM101 / Type A) GN=gmk PE=3 SV=1 617 791 1.0E-10
sp|Q5E8P5|KGUA_VIBF1 Guanylate kinase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=gmk PE=3 SV=1 618 787 1.0E-10
sp|Q30XT1|KGUA_DESAG Guanylate kinase OS=Desulfovibrio alaskensis (strain G20) GN=gmk PE=3 SV=1 611 791 1.0E-10
sp|Q0TPK6|KGUA_CLOP1 Guanylate kinase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=gmk PE=3 SV=1 617 791 1.0E-10
sp|Q5QYH9|KGUA_IDILO Guanylate kinase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=gmk PE=3 SV=1 618 795 2.0E-10
sp|Q31UQ6|KGUA_SHIBS Guanylate kinase OS=Shigella boydii serotype 4 (strain Sb227) GN=gmk PE=3 SV=1 618 804 2.0E-10
sp|Q5P3M0|KGUA_AROAE Guanylate kinase OS=Aromatoleum aromaticum (strain EbN1) GN=gmk PE=3 SV=2 617 805 2.0E-10
sp|Q5N570|KGUA_SYNP6 Guanylate kinase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=gmk PE=3 SV=1 617 796 2.0E-10
sp|Q8XJK8|KGUA_CLOPE Guanylate kinase OS=Clostridium perfringens (strain 13 / Type A) GN=gmk PE=3 SV=3 617 791 2.0E-10
sp|Q12IL8|KGUA_SHEDO Guanylate kinase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=gmk PE=3 SV=1 618 798 2.0E-10
sp|Q1G9H8|KGUA_LACDA Guanylate kinase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=gmk PE=3 SV=1 617 755 2.0E-10
sp|Q9CEE3|KGUA_LACLA Guanylate kinase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=gmk PE=3 SV=1 617 795 2.0E-10
sp|Q1LTY3|KGUA_BAUCH Guanylate kinase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=gmk PE=3 SV=1 618 795 3.0E-10
sp|Q96JB8|MPP4_HUMAN MAGUK p55 subfamily member 4 OS=Homo sapiens GN=MPP4 PE=1 SV=2 617 792 3.0E-10
sp|Q82ZD5|KGUA_ENTFA Guanylate kinase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=gmk PE=3 SV=1 617 795 3.0E-10
sp|Q12DV7|KGUA_POLSJ Guanylate kinase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=gmk PE=3 SV=1 618 758 3.0E-10
sp|Q47UB3|KGUA_COLP3 Guanylate kinase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=gmk PE=3 SV=1 618 795 4.0E-10
sp|Q8EJU6|KGUA_SHEON Guanylate kinase OS=Shewanella oneidensis (strain MR-1) GN=gmk PE=3 SV=1 618 791 4.0E-10
sp|Q66GE5|KGUA_YERPS Guanylate kinase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=gmk PE=3 SV=1 618 791 4.0E-10
sp|Q1CCZ3|KGUA_YERPN Guanylate kinase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=gmk PE=3 SV=1 618 791 4.0E-10
sp|Q8ZJQ2|KGUA_YERPE Guanylate kinase OS=Yersinia pestis GN=gmk PE=3 SV=1 618 791 4.0E-10
sp|Q1C258|KGUA_YERPA Guanylate kinase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=gmk PE=3 SV=1 618 791 4.0E-10
sp|Q8KPQ7|KGUA_SYNE7 Guanylate kinase OS=Synechococcus elongatus (strain PCC 7942) GN=gmk PE=3 SV=2 617 796 5.0E-10
sp|Q21EC9|KGUA_SACD2 Guanylate kinase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=gmk PE=3 SV=2 626 808 5.0E-10
sp|Q21TP7|KGUA_RHOFT Guanylate kinase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=gmk PE=3 SV=1 618 755 5.0E-10
sp|Q7MPW9|KGUA_VIBVY Guanylate kinase OS=Vibrio vulnificus (strain YJ016) GN=gmk PE=3 SV=1 618 787 7.0E-10
sp|Q8DDV6|KGUA_VIBVU Guanylate kinase OS=Vibrio vulnificus (strain CMCP6) GN=gmk PE=3 SV=1 618 787 7.0E-10
sp|Q87TA9|KGUA_VIBPA Guanylate kinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=gmk PE=3 SV=1 618 787 7.0E-10
sp|Q329K8|KGUA_SHIDS Guanylate kinase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=gmk PE=3 SV=1 618 804 8.0E-10
sp|Q38XU0|KGUA_LACSS Guanylate kinase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=gmk PE=3 SV=1 617 809 8.0E-10
sp|Q5HTT7|KGUA_CAMJR Guanylate kinase OS=Campylobacter jejuni (strain RM1221) GN=gmk PE=3 SV=1 617 791 9.0E-10
sp|Q9PNB8|KGUA_CAMJE Guanylate kinase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=gmk PE=3 SV=1 617 791 9.0E-10
sp|Q2YD10|KGUA_NITMU Guanylate kinase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=gmk PE=3 SV=1 618 814 1.0E-09
sp|Q479A8|KGUA_DECAR Guanylate kinase OS=Dechloromonas aromatica (strain RCB) GN=gmk PE=3 SV=1 618 795 1.0E-09
sp|Q1GH67|KGUA_RUEST Guanylate kinase OS=Ruegeria sp. (strain TM1040) GN=gmk PE=3 SV=1 617 810 1.0E-09
sp|Q7N9P2|KGUA_PHOLL Guanylate kinase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=gmk PE=3 SV=1 618 812 1.0E-09
sp|Q39T72|KGUA_GEOMG Guanylate kinase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=gmk PE=3 SV=1 618 795 1.0E-09
sp|Q3MD38|KGUA_ANAVT Guanylate kinase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=gmk PE=3 SV=1 608 797 1.0E-09
sp|Q46YE8|KGUA_CUPPJ Guanylate kinase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=gmk PE=3 SV=1 618 807 2.0E-09
sp|Q6LVP5|KGUA_PHOPR Guanylate kinase OS=Photobacterium profundum GN=gmk PE=3 SV=1 618 787 2.0E-09
sp|Q5M3I4|KGUA_STRT2 Guanylate kinase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=gmk PE=3 SV=1 617 795 2.0E-09
sp|Q5LYX1|KGUA_STRT1 Guanylate kinase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=gmk PE=3 SV=1 617 795 2.0E-09
sp|P60551|KGUA_GEOSL Guanylate kinase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=gmk PE=3 SV=1 618 795 2.0E-09
sp|Q895Q5|KGUA_CLOTE Guanylate kinase OS=Clostridium tetani (strain Massachusetts / E88) GN=gmk PE=3 SV=1 617 795 3.0E-09
sp|Q2LQ62|KGUA_SYNAS Guanylate kinase OS=Syntrophus aciditrophicus (strain SB) GN=gmk PE=3 SV=1 646 791 3.0E-09
sp|Q9HTM2|KGUA_PSEAE Guanylate kinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gmk PE=3 SV=1 618 791 3.0E-09
sp|Q6G053|KGUA_BARQU Guanylate kinase OS=Bartonella quintana (strain Toulouse) GN=gmk PE=3 SV=1 651 804 3.0E-09
sp|Q3K4L8|KGUA_PSEPF Guanylate kinase OS=Pseudomonas fluorescens (strain Pf0-1) GN=gmk PE=3 SV=1 618 791 3.0E-09
sp|Q5HPY1|KGUA_STAEQ Guanylate kinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gmk PE=3 SV=1 617 795 3.0E-09
sp|P0C0M9|KGUA_STAES Guanylate kinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gmk PE=3 SV=1 617 795 4.0E-09
sp|Q4QJK3|KGUA_HAEI8 Guanylate kinase OS=Haemophilus influenzae (strain 86-028NP) GN=gmk PE=3 SV=1 618 791 4.0E-09
sp|P44310|KGUA_HAEIN Guanylate kinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gmk PE=3 SV=1 618 791 4.0E-09
sp|Q3SLI4|KGUA_THIDA Guanylate kinase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=gmk PE=3 SV=1 618 791 4.0E-09
sp|Q6G439|KGUA_BARHE Guanylate kinase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gmk PE=3 SV=1 618 820 5.0E-09
sp|P57509|KGUA_BUCAI Guanylate kinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=gmk PE=3 SV=1 618 791 5.0E-09
sp|Q4L5R1|KGUA_STAHJ Guanylate kinase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=gmk PE=3 SV=1 617 795 5.0E-09
sp|Q6F7H0|KGUA_ACIAD Guanylate kinase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=gmk PE=3 SV=1 618 795 6.0E-09
sp|Q0A5V3|KGUA_ALKEH Guanylate kinase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=gmk PE=3 SV=1 618 786 6.0E-09
sp|Q2GLF7|KGUA_ANAPZ Guanylate kinase OS=Anaplasma phagocytophilum (strain HZ) GN=gmk PE=1 SV=1 626 792 6.0E-09
sp|Q110R6|KGUA_TRIEI Guanylate kinase OS=Trichodesmium erythraeum (strain IMS101) GN=gmk PE=3 SV=1 617 796 7.0E-09
sp|Q88C87|KGUA_PSEPK Guanylate kinase OS=Pseudomonas putida (strain KT2440) GN=gmk PE=3 SV=1 618 787 9.0E-09
sp|Q6P0D7|MPP7_DANRE MAGUK p55 subfamily member 7 OS=Danio rerio GN=mpp7 PE=1 SV=1 617 793 9.0E-09
sp|Q8NX22|KGUA_STAAW Guanylate kinase OS=Staphylococcus aureus (strain MW2) GN=gmk PE=3 SV=1 617 787 1.0E-08
sp|Q6GA04|KGUA_STAAS Guanylate kinase OS=Staphylococcus aureus (strain MSSA476) GN=gmk PE=3 SV=1 617 787 1.0E-08
sp|Q5HGM3|KGUA_STAAC Guanylate kinase OS=Staphylococcus aureus (strain COL) GN=gmk PE=1 SV=1 617 787 1.0E-08
sp|Q2G1U0|KGUA_STAA8 Guanylate kinase OS=Staphylococcus aureus (strain NCTC 8325) GN=gmk PE=3 SV=1 617 787 1.0E-08
sp|Q2FHM9|KGUA_STAA3 Guanylate kinase OS=Staphylococcus aureus (strain USA300) GN=gmk PE=3 SV=1 617 787 1.0E-08
sp|Q1Q973|KGUA_PSYCK Guanylate kinase OS=Psychrobacter cryohalolentis (strain K5) GN=gmk PE=3 SV=1 618 804 1.0E-08
sp|Q8Z0I7|KGUA_NOSS1 Guanylate kinase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gmk PE=3 SV=1 608 797 1.0E-08
sp|Q2S8R2|KGUA_HAHCH Guanylate kinase OS=Hahella chejuensis (strain KCTC 2396) GN=gmk PE=3 SV=1 618 791 1.0E-08
sp|Q65RR5|KGUA_MANSM Guanylate kinase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=gmk PE=3 SV=1 618 787 1.0E-08
sp|Q9KNM4|KGUA_VIBCH Guanylate kinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gmk PE=3 SV=2 618 787 1.0E-08
sp|Q6GHM6|KGUA_STAAR Guanylate kinase OS=Staphylococcus aureus (strain MRSA252) GN=gmk PE=3 SV=1 617 787 1.0E-08
sp|Q2YXF9|KGUA_STAAB Guanylate kinase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=gmk PE=3 SV=1 617 787 1.0E-08
sp|Q31C67|KGUA_PROM9 Guanylate kinase OS=Prochlorococcus marinus (strain MIT 9312) GN=gmk PE=3 SV=1 614 791 1.0E-08
sp|Q7VDB6|KGUA_PROMA Guanylate kinase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=gmk PE=3 SV=1 617 787 1.0E-08
sp|Q2JQB9|KGUA_SYNJA Guanylate kinase OS=Synechococcus sp. (strain JA-3-3Ab) GN=gmk PE=3 SV=1 617 804 2.0E-08
sp|P65218|KGUA_BRUSU Guanylate kinase OS=Brucella suis biovar 1 (strain 1330) GN=gmk PE=3 SV=1 617 755 2.0E-08
sp|P65217|KGUA_BRUME Guanylate kinase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gmk PE=3 SV=1 617 755 2.0E-08
sp|Q57EQ3|KGUA_BRUAB Guanylate kinase OS=Brucella abortus biovar 1 (strain 9-941) GN=gmk PE=3 SV=1 617 755 2.0E-08
sp|Q2YMJ2|KGUA_BRUA2 Guanylate kinase OS=Brucella abortus (strain 2308) GN=gmk PE=3 SV=1 617 755 2.0E-08
sp|Q7VIA1|KGUA_HELHP Guanylate kinase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=gmk PE=3 SV=1 617 791 2.0E-08
sp|Q9JLB0|MPP6_MOUSE MAGUK p55 subfamily member 6 OS=Mus musculus GN=Mpp6 PE=1 SV=1 611 791 2.0E-08
sp|Q88WL7|KGUA_LACPL Guanylate kinase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=gmk PE=3 SV=1 617 795 2.0E-08
sp|Q89AC8|KGUA_BUCBP Guanylate kinase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=gmk PE=3 SV=1 618 795 2.0E-08
sp|Q8Z2H9|KGUA_SALTI Guanylate kinase OS=Salmonella typhi GN=gmk PE=3 SV=1 618 804 2.0E-08
sp|Q5PC40|KGUA_SALPA Guanylate kinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=gmk PE=3 SV=1 618 804 2.0E-08
sp|Q30PL1|KGUA_SULDN Guanylate kinase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=gmk PE=3 SV=1 617 791 2.0E-08
sp|Q984S9|KGUA_RHILO Guanylate kinase OS=Rhizobium loti (strain MAFF303099) GN=gmk PE=3 SV=2 657 787 2.0E-08
sp|Q4FQY7|KGUA_PSYA2 Guanylate kinase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=gmk PE=3 SV=1 618 804 2.0E-08
sp|O14936|CSKP_HUMAN Peripheral plasma membrane protein CASK OS=Homo sapiens GN=CASK PE=1 SV=3 614 795 2.0E-08
sp|Q9X6M5|KGUA_SALTY Guanylate kinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gmk PE=3 SV=1 618 804 2.0E-08
sp|P54936|LIN2_CAEEL Protein lin-2 OS=Caenorhabditis elegans GN=lin-2 PE=1 SV=1 614 740 2.0E-08
sp|Q17QN6|EM55_BOVIN 55 kDa erythrocyte membrane protein OS=Bos taurus GN=MPP1 PE=1 SV=1 614 793 2.0E-08
sp|Q9D5S7|LRGUK_MOUSE Leucine-rich repeat and guanylate kinase domain-containing protein OS=Mus musculus GN=Lrguk PE=1 SV=1 617 795 3.0E-08
sp|O70589|CSKP_MOUSE Peripheral plasma membrane protein CASK OS=Mus musculus GN=Cask PE=1 SV=2 614 795 3.0E-08
sp|Q9PQS9|KGUA_UREPA Guanylate kinase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=gmk PE=3 SV=1 617 795 3.0E-08
sp|P99176|KGUA_STAAN Guanylate kinase OS=Staphylococcus aureus (strain N315) GN=gmk PE=1 SV=1 617 787 3.0E-08
sp|P65219|KGUA_STAAM Guanylate kinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gmk PE=3 SV=1 617 787 3.0E-08
sp|Q97ID0|KGUA_CLOAB Guanylate kinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gmk PE=3 SV=1 617 795 3.0E-08
sp|Q49WZ1|KGUA_STAS1 Guanylate kinase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=gmk PE=3 SV=1 617 795 3.0E-08
sp|Q8K9C7|KGUA_BUCAP Guanylate kinase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=gmk PE=3 SV=1 618 791 3.0E-08
sp|Q8DVK6|KGUA_STRMU Guanylate kinase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=gmk PE=3 SV=1 617 795 4.0E-08
sp|Q9NZW5|MPP6_HUMAN MAGUK p55 subfamily member 6 OS=Homo sapiens GN=MPP6 PE=1 SV=2 611 791 4.0E-08
sp|Q5FJH2|KGUA_LACAC Guanylate kinase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=gmk PE=3 SV=1 617 755 4.0E-08
sp|Q3AC14|KGUA_CARHZ Guanylate kinase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=gmk PE=3 SV=1 617 791 5.0E-08
sp|Q00013|EM55_HUMAN 55 kDa erythrocyte membrane protein OS=Homo sapiens GN=MPP1 PE=1 SV=2 614 793 5.0E-08
sp|P57888|KGUA_PASMU Guanylate kinase OS=Pasteurella multocida (strain Pm70) GN=gmk PE=3 SV=1 618 787 5.0E-08
sp|Q57I92|KGUA_SALCH Guanylate kinase OS=Salmonella choleraesuis (strain SC-B67) GN=gmk PE=3 SV=2 618 804 5.0E-08
sp|Q62915|CSKP_RAT Peripheral plasma membrane protein CASK OS=Rattus norvegicus GN=Cask PE=1 SV=1 614 795 6.0E-08
sp|P0DB95|KGUA_STRPQ Guanylate kinase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=gmk PE=3 SV=1 617 795 6.0E-08
sp|Q48S18|KGUA_STRPM Guanylate kinase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=gmk PE=3 SV=1 617 795 6.0E-08
sp|Q1J5I6|KGUA_STRPF Guanylate kinase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=gmk PE=3 SV=1 617 795 6.0E-08
sp|Q1JFN7|KGUA_STRPD Guanylate kinase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=gmk PE=3 SV=1 617 795 6.0E-08
sp|Q1JKP6|KGUA_STRPC Guanylate kinase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=gmk PE=3 SV=1 617 795 6.0E-08
sp|Q1JAJ4|KGUA_STRPB Guanylate kinase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=gmk PE=3 SV=1 617 795 6.0E-08
sp|P65223|KGUA_STRP8 Guanylate kinase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=gmk PE=3 SV=1 617 795 6.0E-08
sp|Q5XAP1|KGUA_STRP6 Guanylate kinase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=gmk PE=3 SV=1 617 795 6.0E-08
sp|P0DB94|KGUA_STRP3 Guanylate kinase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=gmk PE=3 SV=1 617 795 6.0E-08
sp|Q8DNR5|KGUA_STRR6 Guanylate kinase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=gmk PE=3 SV=1 617 789 6.0E-08
sp|Q96M69|LRGUK_HUMAN Leucine-rich repeat and guanylate kinase domain-containing protein OS=Homo sapiens GN=LRGUK PE=2 SV=1 617 795 6.0E-08
sp|Q48Q15|KGUA_PSE14 Guanylate kinase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=gmk PE=3 SV=2 618 808 7.0E-08
sp|Q99YM5|KGUA_STRP1 Guanylate kinase OS=Streptococcus pyogenes serotype M1 GN=gmk PE=3 SV=1 617 789 7.0E-08
sp|Q97PA3|KGUA_STRPN Guanylate kinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=gmk PE=3 SV=1 617 789 7.0E-08
sp|Q5RDW4|EM55_PONAB 55 kDa erythrocyte membrane protein OS=Pongo abelii GN=MPP1 PE=2 SV=1 614 793 8.0E-08
sp|Q6MU25|KGUA_MYCMS Guanylate kinase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=gmk PE=3 SV=1 617 763 1.0E-07
sp|P70290|EM55_MOUSE 55 kDa erythrocyte membrane protein OS=Mus musculus GN=Mpp1 PE=1 SV=1 614 793 1.0E-07
sp|Q3AWM1|KGUA_SYNS9 Guanylate kinase OS=Synechococcus sp. (strain CC9902) GN=gmk PE=3 SV=2 618 795 1.0E-07
sp|Q94JM2|GMK3_ARATH Guanylate kinase 3, chloroplastic OS=Arabidopsis thaliana GN=GK3 PE=2 SV=1 611 747 1.0E-07
sp|Q5LS25|KGUA_RUEPO Guanylate kinase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=gmk PE=3 SV=1 617 810 1.0E-07
sp|Q92QZ2|KGUA_RHIME Guanylate kinase OS=Rhizobium meliloti (strain 1021) GN=gmk PE=3 SV=1 617 795 1.0E-07
sp|Q8NQ42|KGUA_CORGL Guanylate kinase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=gmk PE=3 SV=2 617 797 1.0E-07
sp|Q13V49|KGUA_BURXL Guanylate kinase OS=Burkholderia xenovorans (strain LB400) GN=gmk PE=3 SV=1 618 808 1.0E-07
sp|Q2SSR8|KGUA_MYCCT Guanylate kinase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=gmk PE=3 SV=1 617 763 1.0E-07
sp|Q24210|CSKP_DROME Peripheral plasma membrane protein CASK OS=Drosophila melanogaster GN=CASK PE=1 SV=4 613 791 2.0E-07
sp|Q4K3R4|KGUA_PSEF5 Guanylate kinase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=gmk PE=3 SV=1 618 787 2.0E-07
sp|Q6F1S1|KGUA_MESFL Guanylate kinase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=gmk PE=3 SV=1 617 763 2.0E-07
sp|Q2SY72|KGUA_BURTA Guanylate kinase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=gmk PE=3 SV=1 618 755 2.0E-07
sp|Q11HG8|KGUA_CHESB Guanylate kinase OS=Chelativorans sp. (strain BNC1) GN=gmk PE=3 SV=1 617 809 2.0E-07
sp|Q7VRJ7|KGUA_BLOFL Guanylate kinase OS=Blochmannia floridanus GN=gmk PE=3 SV=1 618 805 2.0E-07
sp|Q2J840|KGUA_FRASC Guanylate kinase OS=Frankia sp. (strain CcI3) GN=gmk PE=3 SV=1 618 797 2.0E-07
sp|Q4UK55|KGUA_RICFE Guanylate kinase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=gmk PE=3 SV=1 610 795 2.0E-07
sp|A9CB74|EM55_PAPAN 55 kDa erythrocyte membrane protein OS=Papio anubis GN=MPP1 PE=3 SV=1 614 793 2.0E-07
sp|Q9RS38|KGUA_DEIRA Guanylate kinase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=gmk PE=3 SV=2 617 791 3.0E-07
sp|Q2NQS9|KGUA_SODGM Guanylate kinase OS=Sodalis glossinidius (strain morsitans) GN=gmk PE=3 SV=1 618 787 3.0E-07
sp|Q7NRL1|KGUA_CHRVO Guanylate kinase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=gmk PE=3 SV=1 618 787 3.0E-07
sp|Q6DB60|KGUA_PECAS Guanylate kinase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=gmk PE=3 SV=1 618 780 3.0E-07
sp|Q8XXF9|KGUA_RALSO Guanylate kinase OS=Ralstonia solanacearum (strain GMI1000) GN=gmk PE=3 SV=1 609 755 4.0E-07
sp|Q6AJ91|KGUA_DESPS Guanylate kinase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=gmk PE=3 SV=1 618 796 4.0E-07
sp|Q8BVD5|MPP7_MOUSE MAGUK p55 subfamily member 7 OS=Mus musculus GN=Mpp7 PE=1 SV=2 617 791 4.0E-07
sp|Q88BE2|KGUA_PSESM Guanylate kinase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=gmk PE=3 SV=1 618 808 4.0E-07
sp|Q0I5L8|KGUA_HAES1 Guanylate kinase OS=Haemophilus somnus (strain 129Pt) GN=gmk PE=3 SV=2 618 787 5.0E-07
sp|Q24TX4|KGUA_DESHY Guanylate kinase OS=Desulfitobacterium hafniense (strain Y51) GN=gmk PE=3 SV=1 617 791 6.0E-07
sp|Q0S0L7|KGUA_RHOJR Guanylate kinase OS=Rhodococcus jostii (strain RHA1) GN=gmk PE=3 SV=1 617 798 6.0E-07
sp|Q8RHI9|KGUA_FUSNN Guanylate kinase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=gmk PE=3 SV=1 618 791 7.0E-07
sp|Q1GXB9|KGUA_METFK Guanylate kinase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=gmk PE=3 SV=1 618 757 7.0E-07
sp|Q1IK22|KGUA_KORVE Guanylate kinase OS=Koribacter versatilis (strain Ellin345) GN=gmk PE=3 SV=1 618 795 7.0E-07
sp|Q9WV34|MPP2_MOUSE MAGUK p55 subfamily member 2 OS=Mus musculus GN=Mpp2 PE=1 SV=1 611 761 7.0E-07
sp|Q65JT0|KGUA_BACLD Guanylate kinase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=gmk PE=3 SV=1 617 754 7.0E-07
sp|P0C0M8|KGUA_STAEP Guanylate kinase (Fragment) OS=Staphylococcus epidermidis GN=gmk PE=3 SV=1 646 761 8.0E-07
sp|Q0I868|KGUA_SYNS3 Guanylate kinase OS=Synechococcus sp. (strain CC9311) GN=gmk PE=3 SV=1 616 793 8.0E-07
sp|Q2JQ59|KGUA_SYNJB Guanylate kinase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=gmk PE=3 SV=1 610 805 8.0E-07
sp|Q39IL2|KGUA_BURL3 Guanylate kinase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=gmk PE=3 SV=1 618 755 8.0E-07
sp|P65221|KGUA_STRA5 Guanylate kinase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=gmk PE=3 SV=1 617 789 9.0E-07
sp|P65220|KGUA_STRA3 Guanylate kinase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gmk PE=3 SV=1 617 789 9.0E-07
sp|Q3K368|KGUA_STRA1 Guanylate kinase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=gmk PE=3 SV=1 617 789 9.0E-07
sp|Q7MWS7|KGUA_PORGI Guanylate kinase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=gmk PE=3 SV=1 617 791 9.0E-07
sp|Q73HV1|KGUA_WOLPM Guanylate kinase OS=Wolbachia pipientis wMel GN=gmk PE=3 SV=2 617 792 1.0E-06
sp|Q166A7|KGUA_ROSDO Guanylate kinase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=gmk PE=3 SV=1 617 812 1.0E-06
sp|Q14168|MPP2_HUMAN MAGUK p55 subfamily member 2 OS=Homo sapiens GN=MPP2 PE=1 SV=3 611 753 1.0E-06
sp|Q6AF82|KGUA_LEIXX Guanylate kinase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=gmk PE=3 SV=1 617 800 1.0E-06
sp|Q5GS56|KGUA_WOLTR Guanylate kinase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=gmk PE=3 SV=1 617 792 2.0E-06
sp|P60554|KGUA_ONYPE Guanylate kinase OS=Onion yellows phytoplasma (strain OY-M) GN=gmk PE=3 SV=1 617 807 2.0E-06
sp|Q2NIH1|KGUA_AYWBP Guanylate kinase OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=gmk PE=3 SV=1 617 807 2.0E-06
sp|Q2L090|KGUA_BORA1 Guanylate kinase OS=Bordetella avium (strain 197N) GN=gmk PE=3 SV=1 618 755 2.0E-06
sp|Q0AQC4|KGUA_MARMM Guanylate kinase OS=Maricaulis maris (strain MCS10) GN=gmk PE=3 SV=1 626 805 2.0E-06
sp|Q1BY73|KGUA_BURCA Guanylate kinase OS=Burkholderia cenocepacia (strain AU 1054) GN=gmk PE=3 SV=1 618 755 2.0E-06
sp|Q63RV7|KGUA_BURPS Guanylate kinase OS=Burkholderia pseudomallei (strain K96243) GN=gmk PE=3 SV=1 618 755 2.0E-06
sp|Q3JPS9|KGUA_BURP1 Guanylate kinase OS=Burkholderia pseudomallei (strain 1710b) GN=gmk PE=3 SV=1 618 755 2.0E-06
sp|Q62I00|KGUA_BURMA Guanylate kinase OS=Burkholderia mallei (strain ATCC 23344) GN=gmk PE=3 SV=1 618 755 2.0E-06
sp|Q7NK59|KGUA_GLOVI Guanylate kinase OS=Gloeobacter violaceus (strain PCC 7421) GN=gmk PE=3 SV=1 617 796 2.0E-06
sp|Q5WFK3|KGUA_BACSK Guanylate kinase OS=Bacillus clausii (strain KSM-K16) GN=gmk PE=3 SV=1 617 808 2.0E-06
sp|Q7VXZ3|KGUA_BORPE Guanylate kinase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=gmk PE=3 SV=2 618 763 2.0E-06
sp|Q7W6B2|KGUA_BORPA Guanylate kinase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=gmk PE=3 SV=1 618 763 2.0E-06
sp|Q7WI80|KGUA_BORBR Guanylate kinase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=gmk PE=3 SV=1 618 763 2.0E-06
sp|Q98PN5|KGUA_MYCPU Guanylate kinase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=gmk PE=3 SV=1 614 799 2.0E-06
sp|Q3ALX6|KGUA_SYNSC Guanylate kinase OS=Synechococcus sp. (strain CC9605) GN=gmk PE=3 SV=1 617 787 3.0E-06
sp|P49697|EM55_TAKRU 55 kDa erythrocyte membrane protein OS=Takifugu rubripes GN=mpp1 PE=3 SV=1 614 793 3.0E-06
sp|Q47R17|KGUA_THEFY Guanylate kinase OS=Thermobifida fusca (strain YX) GN=gmk PE=3 SV=1 618 755 3.0E-06
sp|Q92GC9|KGUA_RICCN Guanylate kinase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=gmk PE=3 SV=1 617 786 3.0E-06
sp|Q15Z10|KGUA_PSEA6 Guanylate kinase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=gmk PE=3 SV=1 618 806 3.0E-06
sp|Q8G813|KGUA_BIFLO Guanylate kinase OS=Bifidobacterium longum (strain NCC 2705) GN=gmk PE=3 SV=1 617 791 3.0E-06
sp|Q8GAU4|KGUA_STRKA Guanylate kinase OS=Streptomyces kasugaensis GN=gmk PE=3 SV=1 618 751 4.0E-06
sp|Q3JBT3|KGUA_NITOC Guanylate kinase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gmk PE=3 SV=1 618 798 4.0E-06
sp|P60555|KGUA_PROMM Guanylate kinase OS=Prochlorococcus marinus (strain MIT 9313) GN=gmk PE=3 SV=1 618 787 4.0E-06
sp|Q602T6|KGUA_METCA Guanylate kinase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=gmk PE=3 SV=1 618 795 4.0E-06
sp|Q8EVJ9|KGUA_MYCPE Guanylate kinase OS=Mycoplasma penetrans (strain HF-2) GN=gmk PE=3 SV=1 621 803 5.0E-06
sp|Q1IW06|KGUA_DEIGD Guanylate kinase OS=Deinococcus geothermalis (strain DSM 11300) GN=gmk PE=3 SV=1 617 791 5.0E-06
sp|O34328|KGUA_BACSU Guanylate kinase OS=Bacillus subtilis (strain 168) GN=gmk PE=3 SV=2 617 795 5.0E-06
sp|Q4ZZY8|KGUA_PSEU2 Guanylate kinase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=gmk PE=3 SV=1 618 808 5.0E-06
sp|Q9X215|KGUA_THEMA Guanylate kinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gmk PE=3 SV=1 618 795 6.0E-06
sp|Q5ZJ00|EM55_CHICK 55 kDa erythrocyte membrane protein OS=Gallus gallus GN=MPP1 PE=2 SV=1 614 793 8.0E-06
sp|Q7VKP3|KGUA_HAEDU Guanylate kinase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=gmk PE=3 SV=1 618 791 8.0E-06
sp|Q1AVZ3|KGUA_RUBXD Guanylate kinase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=gmk PE=3 SV=1 617 793 9.0E-06
sp|Q7V2K9|KGUA_PROMP Guanylate kinase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=gmk PE=3 SV=1 617 742 9.0E-06
sp|Q5L0S8|KGUA_GEOKA Guanylate kinase OS=Geobacillus kaustophilus (strain HTA426) GN=gmk PE=3 SV=1 617 747 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5492
MPALDITNPGVPVVLSVAKVLAEVLREPCLGQEPTTADLAPEKLSLTKFCNRVVASLTDHGATIEETETSSQESS
KTRQFAIIETAARDIFDKLVETTSINAPDFLNMWKLLDFLSILSDQGQCDPALLFWLVEELLDSQTIAGCRKIFD
YLESRREQITAKHFKQKALVILRTCNELLRRLSRAEDTAFCGRVFIFMFQSFPLGDRSSVNLRGEYHVENVTTFD
SSPSSFETKMCLDEPQTDANKPSKDSKTGIKGVTFDAKNTQDISDSDSLYPLFWSLQESFSQPLKLFDPVYFNHF
KSSLEATMKTFQTIIYEGSNPSKSTQISRQEPKRKRSEAGLDEGPELFNPKYLTSRDLFGLEISDLSFRRHILVQ
ALIIIDFILSLSAGAKEKVAKINPLNKSVIYNDQLTEQNAKWATDMKASISGYLKRGFDGPYFYRTVETVLARDK
NWVFWKMASCPPIQRDAVLSGIFNDCKGCIQRLATNKRLRTTPMGAVSMDFVRQDASGQAMNELQAMDRYQLPEL
DTFKRKIADDDFEIDMPTNASTKATAIAGKASKSWRALRAGARCKLMAFDKIDDSKSVGSVFEPLPVEDSAIDDD
DYGPVDNQETPENREPVIICGSQRVGKSRLVDKLLSTRRGIFAPVVRHAARQAQEGETAGKSFHFVTTQEFNQLR
DGDRLVEYGTRDGVNYGTSIRAVDTLVDSGRVPLIKLDIDAAQFAKGMGFSARYVLILPPNDTNMLKARLARSGL
DDAAVQALVTQMLEQTSPAKVEGLFDKSIVLDDLDQAAETLSEYVYGRSSYKKQHVKEPTRHGVGQESGDVDMED
DEPVTKPVGEGKQQD*
Coding >OphauG2|5492
ATGCCGGCGCTTGATATAACAAACCCGGGAGTCCCCGTTGTGTTAAGCGTGGCCAAGGTGCTGGCAGAAGTGCTA
AGGGAACCATGCCTGGGCCAAGAGCCGACAACGGCGGATTTGGCCCCCGAGAAGCTGTCCTTGACCAAGTTTTGC
AACCGAGTGGTTGCTTCGCTCACCGACCACGGAGCGACTATTGAAGAGACCGAGACCTCTTCGCAAGAATCGAGC
AAGACGAGACAATTTGCCATCATCGAAACTGCAGCAAGAGACATCTTCGACAAACTCGTGGAAACCACGTCAATA
AACGCACCCGATTTCCTTAATATGTGGAAGCTCCTTGACTTCTTGTCAATTCTCTCGGATCAGGGCCAATGCGAT
CCGGCTTTGTTGTTCTGGCTGGTCGAGGAGCTCTTGGACAGTCAGACCATTGCTGGCTGCAGAAAAATCTTTGAC
TATCTCGAATCCAGGCGCGAACAAATCACAGCCAAACACTTTAAACAAAAGGCTCTAGTAATTTTAAGGACCTGC
AATGAGTTATTACGCCGCCTATCTCGCGCCGAGGACACGGCCTTTTGCGGCCGGGTCTTCATCTTCATGTTCCAG
AGCTTCCCACTTGGTGACCGGAGCTCCGTCAACCTTCGTGGCGAGTATCATGTTGAGAATGTCACCACCTTCGAC
AGCAGCCCCTCTTCATTCGAGACTAAGATGTGCTTGGATGAGCCTCAGACAGACGCAAACAAACCCTCCAAGGAC
TCCAAGACTGGAATTAAAGGCGTCACATTTGATGCCAAGAACACACAAGACATTTCGGATTCAGACTCTCTATAC
CCACTCTTTTGGTCGCTCCAGGAAAGCTTCAGCCAGCCCCTCAAACTTTTTGACCCCGTTTACTTCAATCATTTC
AAGTCCAGCCTCGAAGCGACCATGAAGACGTTTCAGACCATCATTTACGAAGGATCAAACCCGTCAAAGTCCACT
CAGATCAGCAGGCAGGAACCAAAACGCAAAAGAAGCGAAGCGGGACTCGACGAAGGCCCGGAGCTCTTCAACCCT
AAATATCTCACAAGCAGGGATCTTTTTGGGCTCGAGATAAGCGATTTATCCTTTAGACGTCATATTCTCGTCCAA
GCTCTAATTATTATCGACTTTATCCTCTCGCTTTCGGCTGGTGCCAAGGAAAAAGTGGCCAAGATCAACCCTTTG
AACAAGTCAGTCATTTACAATGATCAGTTGACCGAGCAAAATGCCAAATGGGCAACCGACATGAAGGCAAGCATC
TCGGGCTACTTGAAAAGAGGTTTCGATGGTCCGTATTTCTACAGGACTGTTGAAACCGTTCTCGCTCGAGACAAA
AACTGGGTCTTTTGGAAGATGGCTAGCTGTCCGCCAATCCAACGAGACGCTGTCTTGAGCGGCATCTTTAACGAT
TGCAAGGGATGTATTCAGCGATTGGCGACCAACAAGCGGCTACGAACTACTCCCATGGGTGCAGTGTCAATGGAT
TTTGTTCGCCAAGACGCCAGCGGCCAAGCCATGAATGAACTTCAAGCTATGGATAGATATCAGCTTCCAGAGCTG
GATACATTCAAGCGGAAAATAGCGGATGACGACTTTGAGATTGACATGCCAACCAATGCGTCCACAAAGGCGACT
GCAATAGCAGGCAAGGCCAGCAAAAGCTGGCGCGCTCTTCGGGCGGGGGCAAGATGCAAATTGATGGCATTTGAC
AAGATTGACGACTCCAAAAGTGTCGGCTCCGTCTTTGAACCACTTCCTGTGGAGGACTCGGCAATTGATGATGAC
GACTATGGGCCCGTCGACAACCAAGAAACCCCGGAAAACCGCGAGCCCGTCATTATTTGCGGATCTCAAAGGGTA
GGGAAATCAAGGCTTGTGGACAAGCTGCTCTCAACCCGTCGAGGCATCTTTGCGCCCGTGGTGCGGCACGCTGCG
CGGCAAGCACAAGAAGGCGAAACGGCTGGCAAAAGCTTCCACTTTGTAACAACACAAGAGTTTAATCAGCTGCGG
GATGGAGATCGGCTGGTTGAGTATGGGACAAGGGATGGAGTCAACTACGGCACCAGCATCAGGGCTGTTGACACT
CTTGTGGACTCTGGCAGAGTCCCTCTTATAAAACTGGATATTGATGCGGCCCAGTTCGCAAAGGGTATGGGCTTT
TCAGCCCGCTACGTTCTTATTCTCCCACCAAACGACACAAACATGTTAAAAGCCCGTCTGGCCCGCTCTGGTCTC
GACGACGCAGCAGTGCAAGCCCTTGTTACGCAAATGCTCGAGCAGACGAGCCCGGCCAAGGTGGAGGGGCTGTTT
GACAAGTCAATTGTCCTTGACGATTTAGATCAGGCGGCAGAAACTTTATCAGAGTATGTCTATGGACGGAGCAGC
TACAAGAAACAGCATGTCAAGGAGCCGACGCGTCATGGTGTTGGGCAAGAAAGTGGCGATGTCGACATGGAGGAT
GATGAGCCGGTAACGAAACCGGTTGGCGAGGGAAAACAACAAGACTGA
Transcript >OphauG2|5492
ATGCCGGCGCTTGATATAACAAACCCGGGAGTCCCCGTTGTGTTAAGCGTGGCCAAGGTGCTGGCAGAAGTGCTA
AGGGAACCATGCCTGGGCCAAGAGCCGACAACGGCGGATTTGGCCCCCGAGAAGCTGTCCTTGACCAAGTTTTGC
AACCGAGTGGTTGCTTCGCTCACCGACCACGGAGCGACTATTGAAGAGACCGAGACCTCTTCGCAAGAATCGAGC
AAGACGAGACAATTTGCCATCATCGAAACTGCAGCAAGAGACATCTTCGACAAACTCGTGGAAACCACGTCAATA
AACGCACCCGATTTCCTTAATATGTGGAAGCTCCTTGACTTCTTGTCAATTCTCTCGGATCAGGGCCAATGCGAT
CCGGCTTTGTTGTTCTGGCTGGTCGAGGAGCTCTTGGACAGTCAGACCATTGCTGGCTGCAGAAAAATCTTTGAC
TATCTCGAATCCAGGCGCGAACAAATCACAGCCAAACACTTTAAACAAAAGGCTCTAGTAATTTTAAGGACCTGC
AATGAGTTATTACGCCGCCTATCTCGCGCCGAGGACACGGCCTTTTGCGGCCGGGTCTTCATCTTCATGTTCCAG
AGCTTCCCACTTGGTGACCGGAGCTCCGTCAACCTTCGTGGCGAGTATCATGTTGAGAATGTCACCACCTTCGAC
AGCAGCCCCTCTTCATTCGAGACTAAGATGTGCTTGGATGAGCCTCAGACAGACGCAAACAAACCCTCCAAGGAC
TCCAAGACTGGAATTAAAGGCGTCACATTTGATGCCAAGAACACACAAGACATTTCGGATTCAGACTCTCTATAC
CCACTCTTTTGGTCGCTCCAGGAAAGCTTCAGCCAGCCCCTCAAACTTTTTGACCCCGTTTACTTCAATCATTTC
AAGTCCAGCCTCGAAGCGACCATGAAGACGTTTCAGACCATCATTTACGAAGGATCAAACCCGTCAAAGTCCACT
CAGATCAGCAGGCAGGAACCAAAACGCAAAAGAAGCGAAGCGGGACTCGACGAAGGCCCGGAGCTCTTCAACCCT
AAATATCTCACAAGCAGGGATCTTTTTGGGCTCGAGATAAGCGATTTATCCTTTAGACGTCATATTCTCGTCCAA
GCTCTAATTATTATCGACTTTATCCTCTCGCTTTCGGCTGGTGCCAAGGAAAAAGTGGCCAAGATCAACCCTTTG
AACAAGTCAGTCATTTACAATGATCAGTTGACCGAGCAAAATGCCAAATGGGCAACCGACATGAAGGCAAGCATC
TCGGGCTACTTGAAAAGAGGTTTCGATGGTCCGTATTTCTACAGGACTGTTGAAACCGTTCTCGCTCGAGACAAA
AACTGGGTCTTTTGGAAGATGGCTAGCTGTCCGCCAATCCAACGAGACGCTGTCTTGAGCGGCATCTTTAACGAT
TGCAAGGGATGTATTCAGCGATTGGCGACCAACAAGCGGCTACGAACTACTCCCATGGGTGCAGTGTCAATGGAT
TTTGTTCGCCAAGACGCCAGCGGCCAAGCCATGAATGAACTTCAAGCTATGGATAGATATCAGCTTCCAGAGCTG
GATACATTCAAGCGGAAAATAGCGGATGACGACTTTGAGATTGACATGCCAACCAATGCGTCCACAAAGGCGACT
GCAATAGCAGGCAAGGCCAGCAAAAGCTGGCGCGCTCTTCGGGCGGGGGCAAGATGCAAATTGATGGCATTTGAC
AAGATTGACGACTCCAAAAGTGTCGGCTCCGTCTTTGAACCACTTCCTGTGGAGGACTCGGCAATTGATGATGAC
GACTATGGGCCCGTCGACAACCAAGAAACCCCGGAAAACCGCGAGCCCGTCATTATTTGCGGATCTCAAAGGGTA
GGGAAATCAAGGCTTGTGGACAAGCTGCTCTCAACCCGTCGAGGCATCTTTGCGCCCGTGGTGCGGCACGCTGCG
CGGCAAGCACAAGAAGGCGAAACGGCTGGCAAAAGCTTCCACTTTGTAACAACACAAGAGTTTAATCAGCTGCGG
GATGGAGATCGGCTGGTTGAGTATGGGACAAGGGATGGAGTCAACTACGGCACCAGCATCAGGGCTGTTGACACT
CTTGTGGACTCTGGCAGAGTCCCTCTTATAAAACTGGATATTGATGCGGCCCAGTTCGCAAAGGGTATGGGCTTT
TCAGCCCGCTACGTTCTTATTCTCCCACCAAACGACACAAACATGTTAAAAGCCCGTCTGGCCCGCTCTGGTCTC
GACGACGCAGCAGTGCAAGCCCTTGTTACGCAAATGCTCGAGCAGACGAGCCCGGCCAAGGTGGAGGGGCTGTTT
GACAAGTCAATTGTCCTTGACGATTTAGATCAGGCGGCAGAAACTTTATCAGAGTATGTCTATGGACGGAGCAGC
TACAAGAAACAGCATGTCAAGGAGCCGACGCGTCATGGTGTTGGGCAAGAAAGTGGCGATGTCGACATGGAGGAT
GATGAGCCGGTAACGAAACCGGTTGGCGAGGGAAAACAACAAGACTGA
Gene >OphauG2|5492
ATGCCGGCGCTTGATATAACAAACCCGGGAGTCCCCGTTGTGTTAAGCGTGGCCAAGGTGCTGGCAGAAGTGCTA
AGGGAACCATGCCTGGGCCAAGAGCCGACAACGGCGGATTTGGCCCCCGAGAAGCTGTCCTTGACCAAGTTTTGC
AACCGAGTGGTTGCTTCGCTCACCGACCACGGAGCGACTATTGAAGAGACCGAGACCTCTTCGCAAGAATCGAGC
AAGACGAGACAATTTGCCATCATCGAAACTGCAGCAAGAGACATCTTCGACAAACTCGTGGTGAGTGTCATTTTT
CTTTCTCCCAGAGATCATTTTCATGCCCATACTGACATTCATGTAGGAAACCACGTCAATAAACGCACCCGATTT
CCTTAATATGTGGAAGCTCCTTGACTTCTTGTCAATTCTCTCGGATCAGGGCCAATGCGATCCGGCTTTGTTGTT
CTGGCTGGTCGAGGAGCTCTTGGACAGTCAGACCATTGCTGGCTGCAGAAAAATCTTTGACTATCTCGAATCCAG
GCGCGAACAAATCACAGCCAAACACTTTAAACAAAAGGCTCTAGTAATTTTAAGGACCTGCAATGAGTTATTACG
CCGCCTATCTCGCGCCGAGGACACGGCCTTTTGCGGCCGGGTCTTCATCTTCATGTTCCAGAGCTTCCCACTTGG
TGACCGGAGCTCCGTCAACCTTCGTGGCGAGTATCATGTTGAGAATGTCACCACCTTCGACAGCAGCCCCTCTTC
ATTCGAGACTAAGATGTGCTTGGATGAGCCTCAGACAGACGCAAACAAACCCTCCAAGGACTCCAAGACTGGAAT
TAAAGGCGTCACATTTGATGCCAAGAACACACAAGACATTTCGGATTCAGACTCTCTATACCCACTCTTTTGGTC
GCTCCAGGAAAGCTTCAGCCAGCCCCTCAAACTTTTTGACCCCGTTTACTTCAATCATTTCAAGTCCAGCCTCGA
AGCGACCATGAAGACGTTTCAGACCATCATTTACGAAGGATCAAACCCGTCAAAGTCCACTCAGATCAGCAGGCA
GGAACCAAAACGCAAAAGAAGCGAAGCGGGACTCGACGAAGGCCCGGAGCTCTTCAACCCTAAATATCTCACAAG
CAGGGATCTTTTTGGGCTCGAGGTAGTCTACGATTTCCGTTCTGCTCCATTTCCACTAACATGGTACAGATAAGC
GATTTATCCTTTAGACGTCATATTCTCGTCCAAGCTCTAATTATTATCGACTTTATCCTCTCGCTTTCGGCTGGT
GCCAAGGAAAAAGTGGCCAAGATCAACCCTTTGAACAAGTCAGTCATTTACAATGATCAGTTGACCGAGCAAAAT
GTAAGACCCGACGCTCTTCGCCCCATGATTTCTCGTTGACTGGTTAGTAGGCCAAATGGGCAACCGACATGAAGG
CAAGCATCTCGGGCTACTTGAAAAGAGGTTTCGATGGTCCGTATTTCTACAGGACTGTTGAAACCGTTCTCGCTC
GAGACAAAAACTGGGTCTTTTGGAAGATGGCTAGCTGTCCGCCAATCCAACGAGACGCTGTCTTGAGCGGCATCT
TTAACGATTGCAAGGGATGTATTCAGCGATTGGCGACCAACAAGCGGCTACGAACTACTCCCATGGGTGCAGTGT
CAATGGATTTTGTTCGCCAAGACGCCAGCGGCCAAGCCATGAATGAACTTCAAGCTATGGATAGATATCAGCTTC
CAGAGCTGGATACATTCAAGCGGAAAATAGCGGATGACGACTTTGAGATTGACATGCCAACCAATGCGTCCACAA
AGGCGACTGCAATAGCAGGCAAGGCCAGCAAAAGCTGGCGCGCTCTTCGGGCGGGGGCAAGATGCAAATTGATGG
CATTTGACAAGATTGACGACTCCAAAAGTGTCGGCTCCGTCTTTGAACCACTTCCTGTGGAGGACTCGGCAATTG
ATGATGACGACTATGGGCCCGTCGACAACCAAGAAACCCCGGAAAACCGCGAGCCCGTCATTATTTGCGGATCTC
AAAGGGTAGGGAAATCAAGGCTTGTGGACAAGCTGCTCTCAACCCGTCGAGGCATCTTTGCGCCCGTGGTGCGGC
ACGCTGCGCGGCAAGCACAAGAAGGCGAAACGGCTGGCAAAAGCTTCCACTTTGTAACAACACAAGAGTTTAATC
AGCTGCGGGATGGAGATCGGCTGGTTGAGTATGGGACAAGGGATGGAGTCAACTACGGCACCAGCATCAGGGCTG
TTGACACTCTTGTGGACTCTGGCAGAGTCCCTCTTATAAAACTGGATATTGATGTGAGTTTTTTTCTTTTGTCTG
GCTCTATTTTTAGACCTCTGTTTTTGAAATGCGACTGTCCAAGTCTGACTTTGTTTCAACGAGTCCAGGCGGCCC
AGTTCGCAAAGGGTATGGGCTTTTCAGCCCGCTACGTTCTTATTCTCCCACCAAACGACACAAACATGTTAAAAG
CCCGTCTGGCCCGCTCTGGTCTCGACGACGCAGCAGTGCAAGCCCTTGTTACGCAAATGCTCGAGCAGACGAGCC
CGGCCAAGGTGGAGGGGCTGTTTGACAAGTCAATTGTCCTTGACGATTTAGATCAGGCGGCAGAAACTTTATCAG
AGTATGTCTATGGACGGAGCAGCTACAAGAAACAGCATGTCAAGGAGCCGACGCGTCATGGTGTTGGGCAAGAAA
GTGGCGATGTCGACATGGAGGATGATGAGCCGGTAACGAAACCGGTTGGCGAGGGAAAACAACAAGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail