Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5476
Gene name
LocationContig_504:8504..9142
Strand+
Gene length (bp)638
Transcript length (bp)552
Coding sequence length (bp)552
Protein length (aa) 184

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08561 Ribosomal_L37 Mitochondrial ribosomal protein L37 7.1E-34 52 182

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7U8|RM37_SCHPO 54S ribosomal protein L37, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl37 PE=3 SV=1 18 91 4.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5476
MLCSRCLTSATSKKGLALLRSFSASSRLRLADPELSTPITQAGEAPQPTSTVRSICRQGTVLRGLNYIKGGQDPV
ALRDDEYPEWLWACLDFKKSGASPDDPNAGDEFSAKTKKTASKTSADGTILAVEPKIPIQHQSINLPGSEGDSIE
DKIAAGARRDELKRAMRKERKAKIKESNFLKSM*
Coding >OphauG2|5476
ATGCTCTGCTCGCGTTGTCTGACATCAGCTACATCAAAAAAAGGCTTAGCCTTACTACGATCGTTCTCAGCATCA
TCACGACTTCGTCTGGCCGACCCCGAGCTCTCTACGCCCATTACCCAAGCTGGCGAGGCACCCCAGCCAACAAGC
ACTGTGAGATCGATCTGTCGTCAAGGCACCGTGCTGCGCGGTCTCAATTATATCAAGGGTGGGCAAGACCCCGTA
GCACTACGCGACGATGAATATCCCGAATGGCTGTGGGCCTGTCTCGACTTTAAGAAGAGCGGCGCAAGCCCCGAT
GATCCCAATGCCGGTGACGAGTTTTCTGCCAAGACGAAAAAGACTGCTTCCAAGACGTCTGCCGACGGCACCATA
CTAGCAGTGGAGCCCAAGATTCCGATACAACATCAATCCATCAACCTGCCAGGCAGTGAAGGAGATAGTATTGAG
GATAAAATTGCGGCTGGAGCCAGGCGGGATGAATTAAAAAGAGCCATGCGAAAGGAGAGGAAGGCCAAGATCAAA
GAAAGCAACTTCCTCAAGTCGATGTAG
Transcript >OphauG2|5476
ATGCTCTGCTCGCGTTGTCTGACATCAGCTACATCAAAAAAAGGCTTAGCCTTACTACGATCGTTCTCAGCATCA
TCACGACTTCGTCTGGCCGACCCCGAGCTCTCTACGCCCATTACCCAAGCTGGCGAGGCACCCCAGCCAACAAGC
ACTGTGAGATCGATCTGTCGTCAAGGCACCGTGCTGCGCGGTCTCAATTATATCAAGGGTGGGCAAGACCCCGTA
GCACTACGCGACGATGAATATCCCGAATGGCTGTGGGCCTGTCTCGACTTTAAGAAGAGCGGCGCAAGCCCCGAT
GATCCCAATGCCGGTGACGAGTTTTCTGCCAAGACGAAAAAGACTGCTTCCAAGACGTCTGCCGACGGCACCATA
CTAGCAGTGGAGCCCAAGATTCCGATACAACATCAATCCATCAACCTGCCAGGCAGTGAAGGAGATAGTATTGAG
GATAAAATTGCGGCTGGAGCCAGGCGGGATGAATTAAAAAGAGCCATGCGAAAGGAGAGGAAGGCCAAGATCAAA
GAAAGCAACTTCCTCAAGTCGATGTAG
Gene >OphauG2|5476
ATGCTCTGCTCGCGTTGTCTGACATCAGCTACATCAAAAAAAGGCTTAGCCTTACTACGATCGTTCTCAGCATCA
TCACGACTTCGTCTGGCCGACCCCGAGCTCTCTACGCCCATTACCCAAGCTGGCGAGGCACCCCAGCCAACAAGC
ACTGTGAGATCGATCTGTCGTCAAGGCACCGTGCTGCGCGGTCTCAATTATATCAAGGGTGGGCAAGACCCCGTA
GCACTACGCGACGATGAATATCCCGAATGGCTGTGGGCCTGTCTCGACTTTAAGAAGAGCGGCGCAAGCCCCGAT
GATCCCAATGCCGGTGACGAGTTTTGTAAGTTGATGCTGCTGAGTTGACTCTCGGCTTGCCCTCGGCGAGTTAAC
TAGATGCAGCAAAATCGAAAACACAGAGACGCTTAGCTGCCAAGACGAAAAAGACTGCTTCCAAGACGTCTGCCG
ACGGCACCATACTAGCAGTGGAGCCCAAGATTCCGATACAACATCAATCCATCAACCTGCCAGGCAGTGAAGGAG
ATAGTATTGAGGATAAAATTGCGGCTGGAGCCAGGCGGGATGAATTAAAAAGAGCCATGCGAAAGGAGAGGAAGG
CCAAGATCAAAGAAAGCAACTTCCTCAAGTCGATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail