Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5474
Gene name
LocationContig_504:5343..7170
Strand-
Gene length (bp)1827
Transcript length (bp)1719
Coding sequence length (bp)1719
Protein length (aa) 573

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 3.2E-17 315 384
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.0E-15 420 484

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 302 502 2.0E-51
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 252 504 1.0E-22
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 313 504 9.0E-22
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 315 504 1.0E-20
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 315 504 1.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 302 502 2.0E-51
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 252 504 1.0E-22
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 313 504 9.0E-22
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 315 504 1.0E-20
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 315 504 1.0E-19
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 313 504 2.0E-19
sp|P19683|ROC4_NICSY 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 313 501 1.0E-18
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 293 504 6.0E-18
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 306 484 1.0E-17
sp|P19682|ROC3_NICSY 28 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 313 504 4.0E-17
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 315 505 3.0E-16
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 315 505 7.0E-16
sp|Q9SX79|RB47C_ARATH Polyadenylate-binding protein RBP47C OS=Arabidopsis thaliana GN=RBP47C PE=2 SV=1 265 484 8.0E-16
sp|Q9FNR1|RBG3_ARATH Glycine-rich RNA-binding protein 3, mitochondrial OS=Arabidopsis thaliana GN=RBG3 PE=2 SV=1 311 393 3.0E-15
sp|Q7SG09|MRD1_NEUCR Multiple RNA-binding domain-containing protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrd-1 PE=3 SV=1 312 499 3.0E-15
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 311 484 6.0E-15
sp|Q9SX80|R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana GN=RBP47C' PE=2 SV=1 265 501 8.0E-15
sp|Q5BGA9|MRD1_EMENI Multiple RNA-binding domain-containing protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mrd1 PE=3 SV=1 311 498 1.0E-14
sp|P20397|NUCL_XENLA Nucleolin OS=Xenopus laevis GN=ncl PE=2 SV=3 288 498 2.0E-14
sp|Q9SVM8|RBG2_ARATH Glycine-rich RNA-binding protein 2, mitochondrial OS=Arabidopsis thaliana GN=RBG2 PE=1 SV=1 312 402 2.0E-14
sp|Q9LIN3|RZ1A_ARATH Glycine-rich RNA-binding protein RZ1A OS=Arabidopsis thaliana GN=RZ1A PE=1 SV=1 315 399 3.0E-14
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 310 484 3.0E-14
sp|W8E7I1|RBM3_CAPHI RNA-binding protein 3 OS=Capra hircus GN=RBM3 PE=2 SV=2 315 389 3.0E-14
sp|O89086|RBM3_MOUSE RNA-binding protein 3 OS=Mus musculus GN=Rbm3 PE=1 SV=1 315 389 7.0E-14
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 241 484 8.0E-14
sp|Q0WW84|RB47B_ARATH Polyadenylate-binding protein RBP47B OS=Arabidopsis thaliana GN=RBP47B PE=2 SV=1 314 484 8.0E-14
sp|P98179|RBM3_HUMAN RNA-binding protein 3 OS=Homo sapiens GN=RBM3 PE=1 SV=1 315 389 9.0E-14
sp|F4I3B3|RB47A_ARATH Polyadenylate-binding protein RBP47A OS=Arabidopsis thaliana GN=RBP47A PE=2 SV=1 314 528 1.0E-13
sp|Q925G0|RBM3_RAT RNA-binding protein 3 OS=Rattus norvegicus GN=Rbm3 PE=1 SV=2 315 389 1.0E-13
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 315 499 1.0E-13
sp|Q9LIS2|RBG4_ARATH Glycine-rich RNA-binding protein 4, mitochondrial OS=Arabidopsis thaliana GN=RBG4 PE=2 SV=1 311 394 2.0E-13
sp|Q9FPJ8|RB45A_ARATH Polyadenylate-binding protein RBP45A OS=Arabidopsis thaliana GN=RBP45A PE=2 SV=1 279 510 2.0E-13
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 323 499 2.0E-13
sp|Q43472|GRP_HORVU Glycine-rich RNA-binding protein blt801 OS=Hordeum vulgare GN=blt801 PE=1 SV=1 315 395 3.0E-13
sp|Q8W034|RNP1_ARATH Heterogeneous nuclear ribonucleoprotein 1 OS=Arabidopsis thaliana GN=RNP1 PE=1 SV=1 315 484 3.0E-13
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 323 499 3.0E-13
sp|Q6CDH3|PABP_YARLI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAB1 PE=3 SV=1 312 506 5.0E-13
sp|P60825|CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus GN=Cirbp PE=2 SV=1 315 389 6.0E-13
sp|P60824|CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus GN=Cirbp PE=1 SV=1 315 389 6.0E-13
sp|P60826|CIRBP_CRIGR Cold-inducible RNA-binding protein OS=Cricetulus griseus GN=CIRBP PE=2 SV=1 315 389 6.0E-13
sp|Q5JQF8|PAP1M_HUMAN Polyadenylate-binding protein 1-like 2 OS=Homo sapiens GN=PABPC1L2A PE=2 SV=1 313 493 6.0E-13
sp|Q5RF83|CIRBP_PONAB Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1 315 389 9.0E-13
sp|Q14011|CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1 315 389 9.0E-13
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 306 484 1.0E-12
sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 314 484 1.0E-12
sp|Q39061|CP33_ARATH RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana GN=CP33 PE=2 SV=1 315 501 1.0E-12
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 315 485 1.0E-12
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 420 523 2.0E-12
sp|A1CRM1|PABP_ASPCL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pab1 PE=3 SV=1 264 484 2.0E-12
sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens GN=RBM39 PE=1 SV=2 314 484 2.0E-12
sp|P0CR16|MRD1_CRYNJ Multiple RNA-binding domain-containing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MRD1 PE=3 SV=1 308 498 2.0E-12
sp|P0CR17|MRD1_CRYNB Multiple RNA-binding domain-containing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MRD1 PE=3 SV=1 308 498 2.0E-12
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 312 484 2.0E-12
sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 314 484 2.0E-12
sp|Q9C909|RBG5_ARATH Glycine-rich RNA-binding protein 5, mitochondrial OS=Arabidopsis thaliana GN=RBG5 PE=2 SV=1 299 389 3.0E-12
sp|Q2UK72|PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pab1 PE=3 SV=1 298 484 3.0E-12
sp|Q5B630|PABP_EMENI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pab1 PE=2 SV=2 264 484 3.0E-12
sp|Q0U1G2|PABP_PHANO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAB1 PE=3 SV=3 269 484 3.0E-12
sp|Q9DED4|CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis GN=cirbp-b PE=1 SV=1 315 389 4.0E-12
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 313 484 4.0E-12
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 313 484 4.0E-12
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 313 484 4.0E-12
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 313 484 4.0E-12
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 313 484 4.0E-12
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 313 484 5.0E-12
sp|Q6FKG4|PABP_CANGA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 307 487 5.0E-12
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 312 484 5.0E-12
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 420 523 6.0E-12
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 310 484 6.0E-12
sp|Q6FXP4|MRD1_CANGA Multiple RNA-binding domain-containing protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRD1 PE=3 SV=1 299 485 6.0E-12
sp|Q9Y4C8|RBM19_HUMAN Probable RNA-binding protein 19 OS=Homo sapiens GN=RBM19 PE=1 SV=3 313 483 7.0E-12
sp|A2Q848|PABP_ASPNC Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pab1 PE=3 SV=1 298 484 8.0E-12
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 315 485 9.0E-12
sp|Q9SYG4|UBP1A_ARATH Oligouridylate-binding protein 1A OS=Arabidopsis thaliana GN=UBP1A PE=1 SV=1 315 502 9.0E-12
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 315 484 1.0E-11
sp|Q4WK03|PABP_ASPFU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 304 484 1.0E-11
sp|Q9LEB3|RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia GN=RBP47 PE=1 SV=1 314 526 1.0E-11
sp|Q0CR95|PABP_ASPTN Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pab1 PE=3 SV=1 312 484 1.0E-11
sp|A1D4K4|PABP_NEOFI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 312 484 1.0E-11
sp|Q10355|YDB2_SCHPO Uncharacterized RNA-binding protein C22E12.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22E12.02 PE=3 SV=1 304 389 1.0E-11
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 313 484 1.0E-11
sp|Q03250|RBG7_ARATH Glycine-rich RNA-binding protein 7 OS=Arabidopsis thaliana GN=RBG7 PE=1 SV=1 315 390 1.0E-11
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 313 484 2.0E-11
sp|P39697|RT19_ARATH 40S ribosomal protein S19, mitochondrial OS=Arabidopsis thaliana GN=RPS19 PE=1 SV=2 311 390 2.0E-11
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 315 484 2.0E-11
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 315 389 2.0E-11
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 313 484 2.0E-11
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 313 484 3.0E-11
sp|Q93W34|RP45C_ARATH Polyadenylate-binding protein RBP45C OS=Arabidopsis thaliana GN=RBP45C PE=2 SV=1 314 497 3.0E-11
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 310 484 3.0E-11
sp|P48809|RB27C_DROME Heterogeneous nuclear ribonucleoprotein 27C OS=Drosophila melanogaster GN=Hrb27C PE=1 SV=2 315 484 3.0E-11
sp|P49310|GRP1_SINAL Glycine-rich RNA-binding protein GRP1A OS=Sinapis alba PE=2 SV=1 315 390 3.0E-11
sp|Q4R4J7|NUCL_MACFA Nucleolin OS=Macaca fascicularis GN=NCL PE=2 SV=3 284 497 4.0E-11
sp|Q9PTX2|CIRBP_LITCT Cold-inducible RNA-binding protein OS=Lithobates catesbeiana GN=cirbp PE=2 SV=1 315 395 5.0E-11
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 309 392 5.0E-11
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 313 484 6.0E-11
sp|Q98SJ2|DAZP1_XENLA DAZ-associated protein 1 OS=Xenopus laevis GN=dazap1 PE=1 SV=1 315 484 7.0E-11
sp|Q06106|MRD1_YEAST Multiple RNA-binding domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRD1 PE=1 SV=1 308 485 7.0E-11
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 315 480 8.0E-11
sp|Q03878|GRP1_DAUCA Glycine-rich RNA-binding protein OS=Daucus carota PE=2 SV=1 310 390 8.0E-11
sp|Q7S6N6|PABP_NEUCR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pabp-1 PE=3 SV=1 310 484 9.0E-11
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 308 487 9.0E-11
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 291 521 1.0E-10
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 313 484 1.0E-10
sp|Q86U06|RBM23_HUMAN Probable RNA-binding protein 23 OS=Homo sapiens GN=RBM23 PE=1 SV=1 314 484 1.0E-10
sp|Q9LEB4|RBP45_NICPL Polyadenylate-binding protein RBP45 OS=Nicotiana plumbaginifolia GN=RBP45 PE=1 SV=1 309 497 1.0E-10
sp|Q9SAB3|RB45B_ARATH Polyadenylate-binding protein RBP45B OS=Arabidopsis thaliana GN=RBP45B PE=1 SV=1 309 484 1.0E-10
sp|Q8R3C6|RBM19_MOUSE Probable RNA-binding protein 19 OS=Mus musculus GN=Rbm19 PE=1 SV=1 313 483 1.0E-10
sp|P49311|GRP2_SINAL Glycine-rich RNA-binding protein GRP2A OS=Sinapis alba PE=2 SV=1 316 390 1.0E-10
sp|Q4WJT7|MRD1_ASPFU Multiple RNA-binding domain-containing protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mrd1 PE=3 SV=1 311 498 1.0E-10
sp|Q9JII5|DAZP1_MOUSE DAZ-associated protein 1 OS=Mus musculus GN=Dazap1 PE=1 SV=2 315 484 1.0E-10
sp|O93235|CIRBA_XENLA Cold-inducible RNA-binding protein A OS=Xenopus laevis GN=cirbp-a PE=1 SV=2 315 389 1.0E-10
sp|Q99729|ROAA_HUMAN Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens GN=HNRNPAB PE=1 SV=2 306 501 2.0E-10
sp|O14369|SCE3_SCHPO Probable RNA-binding protein sce3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sce3 PE=1 SV=1 310 392 2.0E-10
sp|Q8VXZ9|R47BP_ARATH Polyadenylate-binding protein RBP47B' OS=Arabidopsis thaliana GN=RBP47B' PE=2 SV=1 314 484 2.0E-10
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 277 484 2.0E-10
sp|Q9LJH8|UBP1C_ARATH Oligouridylate-binding protein 1C OS=Arabidopsis thaliana GN=UBP1C PE=1 SV=1 315 503 2.0E-10
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 310 392 3.0E-10
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 312 487 3.0E-10
sp|Q99020|ROAA_MOUSE Heterogeneous nuclear ribonucleoprotein A/B OS=Mus musculus GN=Hnrnpab PE=1 SV=1 306 501 3.0E-10
sp|Q5M9F1|RBM34_RAT RNA-binding protein 34 OS=Rattus norvegicus GN=Rbm34 PE=1 SV=1 314 485 3.0E-10
sp|Q96EP5|DAZP1_HUMAN DAZ-associated protein 1 OS=Homo sapiens GN=DAZAP1 PE=1 SV=1 315 484 4.0E-10
sp|Q2GSX8|PABP_CHAGB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAB1 PE=3 SV=1 310 501 4.0E-10
sp|P19684|ROC5_NICSY 33 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 315 503 4.0E-10
sp|P52912|TIA1_MOUSE Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=1 315 484 5.0E-10
sp|P32588|PUB1_YEAST Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUB1 PE=1 SV=4 301 392 5.0E-10
sp|Q6CEW9|MRD1_YARLI Multiple RNA-binding domain-containing protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRD1 PE=3 SV=1 311 499 6.0E-10
sp|O97018|SXL_CHRRU Sex-lethal homolog OS=Chrysomya rufifacies GN=SXL PE=2 SV=2 272 499 6.0E-10
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 315 499 6.0E-10
sp|Q6FKG4|PABP_CANGA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 315 482 7.0E-10
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 323 484 7.0E-10
sp|P31483|TIA1_HUMAN Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=TIA1 PE=1 SV=3 315 484 7.0E-10
sp|Q8C5L7|RBM34_MOUSE RNA-binding protein 34 OS=Mus musculus GN=Rbm34 PE=1 SV=1 314 485 7.0E-10
sp|P60825|CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus GN=Cirbp PE=2 SV=1 420 512 9.0E-10
sp|P60824|CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus GN=Cirbp PE=1 SV=1 420 512 9.0E-10
sp|P60826|CIRBP_CRIGR Cold-inducible RNA-binding protein OS=Cricetulus griseus GN=CIRBP PE=2 SV=1 420 512 9.0E-10
sp|P10979|GRPA_MAIZE Glycine-rich RNA-binding, abscisic acid-inducible protein OS=Zea mays GN=RAB15 PE=1 SV=1 316 390 9.0E-10
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 312 481 1.0E-09
sp|O04319|PABP6_ARATH Polyadenylate-binding protein 6 OS=Arabidopsis thaliana GN=PAB6 PE=2 SV=1 290 484 1.0E-09
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 278 484 1.0E-09
sp|Q5RF83|CIRBP_PONAB Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1 420 512 2.0E-09
sp|Q14011|CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1 420 512 2.0E-09
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 315 499 2.0E-09
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 315 499 2.0E-09
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 315 487 2.0E-09
sp|O60176|YG41_SCHPO Uncharacterized RNA-binding protein C23E6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.01c PE=1 SV=2 314 497 2.0E-09
sp|O74400|YOCE_SCHPO Uncharacterized RNA-binding protein C4F6.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4F6.14 PE=1 SV=1 419 501 2.0E-09
sp|Q14103|HNRPD_HUMAN Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens GN=HNRNPD PE=1 SV=1 315 478 2.0E-09
sp|Q03251|RBG8_ARATH Glycine-rich RNA-binding protein 8 OS=Arabidopsis thaliana GN=RBG8 PE=1 SV=1 310 390 2.0E-09
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 310 393 3.0E-09
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 315 499 3.0E-09
sp|Q9JJ54|HNRPD_RAT Heterogeneous nuclear ribonucleoprotein D0 OS=Rattus norvegicus GN=Hnrnpd PE=1 SV=2 269 478 3.0E-09
sp|Q99069|GRP1_SORBI Glycine-rich RNA-binding protein 1 (Fragment) OS=Sorghum bicolor GN=GRP1 PE=2 SV=1 328 390 3.0E-09
sp|Q5RF26|NUCL_PONAB Nucleolin OS=Pongo abelii GN=NCL PE=2 SV=3 284 497 3.0E-09
sp|Q60668|HNRPD_MOUSE Heterogeneous nuclear ribonucleoprotein D0 OS=Mus musculus GN=Hnrnpd PE=1 SV=2 315 478 3.0E-09
sp|P70318|TIAR_MOUSE Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=1 SV=1 315 484 3.0E-09
sp|P52912|TIA1_MOUSE Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=1 309 503 4.0E-09
sp|P31483|TIA1_HUMAN Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=TIA1 PE=1 SV=3 309 503 4.0E-09
sp|O94432|YHKF_SCHPO Uncharacterized RNA-binding protein C660.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC660.15 PE=3 SV=1 315 468 4.0E-09
sp|Q01085|TIAR_HUMAN Nucleolysin TIAR OS=Homo sapiens GN=TIAL1 PE=1 SV=1 315 484 4.0E-09
sp|P19682|ROC3_NICSY 28 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 308 392 5.0E-09
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 310 484 5.0E-09
sp|P53883|NOP13_YEAST Nucleolar protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP13 PE=1 SV=2 309 505 5.0E-09
sp|P82277|RRP2_SPIOL 30S ribosomal protein 2, chloroplastic OS=Spinacia oleracea GN=PSRP2 PE=1 SV=1 280 484 6.0E-09
sp|Q9SIX3|RBG1_ARATH Probable glycine-rich RNA-binding protein 1 OS=Arabidopsis thaliana GN=RBG1 PE=2 SV=2 315 384 7.0E-09
sp|O13845|RSD1_SCHPO RNA-binding protein rsd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsd1 PE=1 SV=2 314 495 7.0E-09
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 315 499 8.0E-09
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 315 499 8.0E-09
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 323 484 8.0E-09
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 315 499 8.0E-09
sp|P0CP46|PABP_CRYNJ Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAB1 PE=3 SV=1 309 484 8.0E-09
sp|P0CP47|PABP_CRYNB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAB1 PE=3 SV=1 309 484 8.0E-09
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 310 392 9.0E-09
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 310 392 9.0E-09
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 315 480 9.0E-09
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 315 481 1.0E-08
sp|A2Q848|PABP_ASPNC Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pab1 PE=3 SV=1 315 487 1.0E-08
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 312 484 1.0E-08
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 311 487 1.0E-08
sp|Q9LQI9|UBP1B_ARATH Oligouridylate-binding protein 1B OS=Arabidopsis thaliana GN=UBP1B PE=1 SV=1 315 483 1.0E-08
sp|Q6CQR6|MRD1_KLULA Multiple RNA-binding domain-containing protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MRD1 PE=3 SV=1 312 502 1.0E-08
sp|Q99070|GRP2_SORBI Glycine-rich RNA-binding protein 2 OS=Sorghum bicolor GN=GRP2 PE=2 SV=1 316 390 1.0E-08
sp|Q39061|CP33_ARATH RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana GN=CP33 PE=2 SV=1 315 397 2.0E-08
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 315 487 2.0E-08
sp|O93235|CIRBA_XENLA Cold-inducible RNA-binding protein A OS=Xenopus laevis GN=cirbp-a PE=1 SV=2 420 496 2.0E-08
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 259 481 2.0E-08
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 310 484 2.0E-08
sp|Q9M427|UBP1_NICPL Oligouridylate-binding protein 1 OS=Nicotiana plumbaginifolia GN=UBP1 PE=2 SV=1 315 500 2.0E-08
sp|Q9WX37|RBPE_NOSS1 Putative RNA-binding protein RbpE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpE PE=3 SV=3 419 501 2.0E-08
sp|Q9FZ84|RBG6_ARATH Glycine-rich RNA-binding protein 6, mitochondrial OS=Arabidopsis thaliana GN=RBG6 PE=2 SV=1 277 384 2.0E-08
sp|Q75A83|MRD1_ASHGO Multiple RNA-binding domain-containing protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRD1 PE=3 SV=2 282 485 2.0E-08
sp|O01671|SXL_MEGSC Sex-lethal homolog OS=Megaselia scalaris GN=SXL PE=2 SV=3 308 532 3.0E-08
sp|P42696|RBM34_HUMAN RNA-binding protein 34 OS=Homo sapiens GN=RBM34 PE=1 SV=2 314 485 3.0E-08
sp|O13620|MRD1_SCHPO Multiple RNA-binding domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrd1 PE=3 SV=1 300 498 3.0E-08
sp|P08199|NUCL_MESAU Nucleolin OS=Mesocricetus auratus GN=NCL PE=1 SV=2 301 484 3.0E-08
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 306 487 3.0E-08
sp|P19683|ROC4_NICSY 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 308 393 4.0E-08
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 282 484 4.0E-08
sp|Q43349|CP29A_ARATH 29 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP29A PE=2 SV=2 315 392 4.0E-08
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 419 497 5.0E-08
sp|Q9Y4C8|RBM19_HUMAN Probable RNA-binding protein 19 OS=Homo sapiens GN=RBM19 PE=1 SV=3 253 481 5.0E-08
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 413 496 5.0E-08
sp|Q8VXZ9|R47BP_ARATH Polyadenylate-binding protein RBP47B' OS=Arabidopsis thaliana GN=RBP47B' PE=2 SV=1 307 501 5.0E-08
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 313 484 5.0E-08
sp|Q05966|GRP10_BRANA Glycine-rich RNA-binding protein 10 OS=Brassica napus GN=GRP10 PE=2 SV=1 310 390 5.0E-08
sp|A7VJC2|ROA2_RAT Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Rattus norvegicus GN=Hnrnpa2b1 PE=1 SV=1 315 483 5.0E-08
sp|Q9PTX2|CIRBP_LITCT Cold-inducible RNA-binding protein OS=Lithobates catesbeiana GN=cirbp PE=2 SV=1 413 496 6.0E-08
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 315 484 6.0E-08
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 420 507 7.0E-08
sp|Q5R723|PPIE_PONAB Peptidyl-prolyl cis-trans isomerase E OS=Pongo abelii GN=PPIE PE=2 SV=1 314 390 7.0E-08
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 317 501 7.0E-08
sp|Q9UNP9|PPIE_HUMAN Peptidyl-prolyl cis-trans isomerase E OS=Homo sapiens GN=PPIE PE=1 SV=1 314 390 7.0E-08
sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 315 393 8.0E-08
sp|O74400|YOCE_SCHPO Uncharacterized RNA-binding protein C4F6.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4F6.14 PE=1 SV=1 311 498 8.0E-08
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 317 501 8.0E-08
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 317 501 8.0E-08
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 317 501 8.0E-08
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 317 501 8.0E-08
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 317 501 8.0E-08
sp|Q5RBU8|ROA2_PONAB Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Pongo abelii GN=HNRNPA2B1 PE=2 SV=1 315 466 8.0E-08
sp|A4FV72|PPIE_BOVIN Peptidyl-prolyl cis-trans isomerase E OS=Bos taurus GN=PPIE PE=2 SV=1 314 390 8.0E-08
sp|W8E7I1|RBM3_CAPHI RNA-binding protein 3 OS=Capra hircus GN=RBM3 PE=2 SV=2 413 524 9.0E-08
sp|Q43349|CP29A_ARATH 29 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP29A PE=2 SV=2 420 504 9.0E-08
sp|O17310|SXL_MUSDO Sex-lethal homolog OS=Musca domestica GN=SXL PE=2 SV=1 315 499 9.0E-08
sp|O88569|ROA2_MOUSE Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Mus musculus GN=Hnrnpa2b1 PE=1 SV=2 315 466 9.0E-08
sp|P22626|ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens GN=HNRNPA2B1 PE=1 SV=2 315 466 9.0E-08
sp|B4KX02|SHEP_DROMO Protein alan shepard OS=Drosophila mojavensis GN=shep PE=3 SV=1 315 485 9.0E-08
sp|A1CRM1|PABP_ASPCL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pab1 PE=3 SV=1 315 480 1.0E-07
sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens GN=RBM39 PE=1 SV=2 315 393 1.0E-07
sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 315 393 1.0E-07
sp|P32588|PUB1_YEAST Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUB1 PE=1 SV=4 314 501 1.0E-07
sp|Q9QZH3|PPIE_MOUSE Peptidyl-prolyl cis-trans isomerase E OS=Mus musculus GN=Ppie PE=1 SV=2 314 390 1.0E-07
sp|Q2HJ60|ROA2_BOVIN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Bos taurus GN=HNRNPA2B1 PE=2 SV=1 315 466 1.0E-07
sp|Q15427|SF3B4_HUMAN Splicing factor 3B subunit 4 OS=Homo sapiens GN=SF3B4 PE=1 SV=1 313 498 1.0E-07
sp|P51990|RO22_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 2 OS=Xenopus laevis PE=2 SV=1 315 466 1.0E-07
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 315 484 1.0E-07
sp|P51989|RO21_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 1 OS=Xenopus laevis PE=2 SV=1 315 466 1.0E-07
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 313 401 2.0E-07
sp|Q9NW13|RBM28_HUMAN RNA-binding protein 28 OS=Homo sapiens GN=RBM28 PE=1 SV=3 311 498 2.0E-07
sp|Q14576|ELAV3_HUMAN ELAV-like protein 3 OS=Homo sapiens GN=ELAVL3 PE=2 SV=3 304 481 2.0E-07
sp|Q60900|ELAV3_MOUSE ELAV-like protein 3 OS=Mus musculus GN=Elavl3 PE=1 SV=1 304 481 2.0E-07
sp|P17130|ROA1_XENLA Heterogeneous nuclear ribonucleoproteins A1 homolog OS=Xenopus laevis GN=hnrnpa1 PE=2 SV=1 315 466 2.0E-07
sp|Q6AYL5|SF3B4_RAT Splicing factor 3B subunit 4 OS=Rattus norvegicus GN=Sf3b4 PE=2 SV=1 313 498 2.0E-07
sp|Q8QZY9|SF3B4_MOUSE Splicing factor 3B subunit 4 OS=Mus musculus GN=Sf3b4 PE=1 SV=1 313 498 2.0E-07
sp|Q7ZX83|HNDLA_XENLA Heterogeneous nuclear ribonucleoprotein D-like-A OS=Xenopus laevis GN=hnrnpdl-a PE=2 SV=1 304 477 2.0E-07
sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 303 498 2.0E-07
sp|Q9TTV2|ROA2_SAGOE Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Saguinus oedipus GN=HNRNPA2B1 PE=1 SV=1 315 466 2.0E-07
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 323 499 3.0E-07
sp|O04319|PABP6_ARATH Polyadenylate-binding protein 6 OS=Arabidopsis thaliana GN=PAB6 PE=2 SV=1 313 484 3.0E-07
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 302 484 3.0E-07
sp|Q9WUK2|IF4H_MOUSE Eukaryotic translation initiation factor 4H OS=Mus musculus GN=Eif4h PE=1 SV=3 419 564 3.0E-07
sp|Q4PC17|MRD1_USTMA Multiple RNA-binding domain-containing protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MRD1 PE=3 SV=1 309 485 3.0E-07
sp|O22703|RZ1B_ARATH Glycine-rich RNA-binding protein RZ1B OS=Arabidopsis thaliana GN=RZ1B PE=2 SV=1 315 390 3.0E-07
sp|Q5ZI72|HNRDL_CHICK Heterogeneous nuclear ribonucleoprotein D-like OS=Gallus gallus GN=HNRNPDL PE=2 SV=1 315 477 3.0E-07
sp|P26378|ELAV4_HUMAN ELAV-like protein 4 OS=Homo sapiens GN=ELAVL4 PE=1 SV=2 303 498 3.0E-07
sp|Q09442|SF3B4_CAEEL Splicing factor 3B subunit 4 OS=Caenorhabditis elegans GN=sap-49 PE=1 SV=2 313 501 3.0E-07
sp|Q44560|RBPA_NOSS1 Putative RNA-binding protein RbpA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpA PE=3 SV=3 419 501 3.0E-07
sp|Q9DED4|CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis GN=cirbp-b PE=1 SV=1 420 496 4.0E-07
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 315 484 4.0E-07
sp|P48810|RB87F_DROME Heterogeneous nuclear ribonucleoprotein 87F OS=Drosophila melanogaster GN=Hrb87F PE=2 SV=2 315 466 4.0E-07
sp|Q61701|ELAV4_MOUSE ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 303 498 4.0E-07
sp|Q10422|YDC1_SCHPO Uncharacterized RNA-binding protein C25G10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25G10.01 PE=1 SV=1 315 398 4.0E-07
sp|Q9VVE5|MSIR6_DROME RNA-binding protein Musashi homolog Rbp6 OS=Drosophila melanogaster GN=Rbp6 PE=2 SV=3 315 501 4.0E-07
sp|Q3SWU3|HNRDL_RAT Heterogeneous nuclear ribonucleoprotein D-like OS=Rattus norvegicus GN=Hnrnpdl PE=1 SV=1 315 477 4.0E-07
sp|Q5XI72|IF4H_RAT Eukaryotic translation initiation factor 4H OS=Rattus norvegicus GN=Eif4h PE=1 SV=1 419 564 4.0E-07
sp|Q6C2Q7|NOP12_YARLI Nucleolar protein 12 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NOP12 PE=3 SV=1 304 495 4.0E-07
sp|O14979|HNRDL_HUMAN Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens GN=HNRNPDL PE=1 SV=3 315 477 4.0E-07
sp|Q91584|ELAV3_XENLA ELAV-like protein 3 OS=Xenopus laevis GN=elavl3 PE=2 SV=1 304 481 4.0E-07
sp|Q2UK72|PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pab1 PE=3 SV=1 315 484 5.0E-07
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 315 484 5.0E-07
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 315 484 5.0E-07
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 315 484 5.0E-07
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 315 484 5.0E-07
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 315 484 5.0E-07
sp|Q3ZC34|RBMS2_BOVIN RNA-binding motif, single-stranded-interacting protein 2 OS=Bos taurus GN=RBMS2 PE=2 SV=1 306 484 5.0E-07
sp|B3NGA1|SHEP_DROER Protein alan shepard OS=Drosophila erecta GN=shep PE=3 SV=1 315 484 5.0E-07
sp|Q54PB2|MRD1_DICDI Multiple RNA-binding domain-containing protein 1 OS=Dictyostelium discoideum GN=mrd1 PE=3 SV=1 355 499 5.0E-07
sp|B4HUE4|SHEP_DROSE Protein alan shepard OS=Drosophila sechellia GN=shep PE=3 SV=1 315 484 5.0E-07
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 302 480 6.0E-07
sp|B4PIS2|SHEP_DROYA Protein alan shepard OS=Drosophila yakuba GN=shep PE=3 SV=1 315 484 6.0E-07
sp|Q4P8R9|PABP_USTMA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAB1 PE=3 SV=1 314 484 6.0E-07
sp|Q925G0|RBM3_RAT RNA-binding protein 3 OS=Rattus norvegicus GN=Rbm3 PE=1 SV=2 413 528 7.0E-07
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 315 484 7.0E-07
sp|Q5B630|PABP_EMENI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pab1 PE=2 SV=2 315 480 8.0E-07
sp|Q7S6N6|PABP_NEUCR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pabp-1 PE=3 SV=1 315 481 8.0E-07
sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 216 484 8.0E-07
sp|P38922|HRB1_YEAST Protein HRB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRB1 PE=1 SV=2 312 494 8.0E-07
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 298 502 9.0E-07
sp|Q9FNR1|RBG3_ARATH Glycine-rich RNA-binding protein 3, mitochondrial OS=Arabidopsis thaliana GN=RBG3 PE=2 SV=1 420 501 9.0E-07
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 315 484 9.0E-07
sp|O89086|RBM3_MOUSE RNA-binding protein 3 OS=Mus musculus GN=Rbm3 PE=1 SV=1 413 498 1.0E-06
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 312 484 1.0E-06
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 315 487 1.0E-06
sp|P26378|ELAV4_HUMAN ELAV-like protein 4 OS=Homo sapiens GN=ELAVL4 PE=1 SV=2 216 484 1.0E-06
sp|Q09442|SF3B4_CAEEL Splicing factor 3B subunit 4 OS=Caenorhabditis elegans GN=sap-49 PE=1 SV=2 310 441 1.0E-06
sp|Q61701|ELAV4_MOUSE ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 216 484 1.0E-06
sp|Q60899|ELAV2_MOUSE ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2 SV=1 308 498 1.0E-06
sp|Q24668|SXL_DROSU Protein sex-lethal OS=Drosophila subobscura GN=Sxl PE=2 SV=2 311 499 1.0E-06
sp|Q5R9Z6|ELAV2_PONAB ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2 SV=1 308 498 1.0E-06
sp|Q12926|ELAV2_HUMAN ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1 SV=2 308 498 1.0E-06
sp|Q9Z130|HNRDL_MOUSE Heterogeneous nuclear ribonucleoprotein D-like OS=Mus musculus GN=Hnrnpdl PE=1 SV=1 315 477 1.0E-06
sp|O61374|SXL_CERCA Sex-lethal homolog OS=Ceratitis capitata GN=SXL PE=2 SV=2 315 499 1.0E-06
sp|Q640A2|HNRDL_XENTR Heterogeneous nuclear ribonucleoprotein D-like OS=Xenopus tropicalis GN=hnrnpdl PE=2 SV=1 304 479 1.0E-06
sp|Q6IQE0|PU60B_DANRE Poly(U)-binding-splicing factor PUF60-B OS=Danio rerio GN=puf60b PE=2 SV=2 315 480 1.0E-06
sp|Q8MSV2|SHEP_DROME Protein alan shepard OS=Drosophila melanogaster GN=shep PE=1 SV=2 315 484 1.0E-06
sp|Q28GD4|ELAV2_XENTR ELAV-like protein 2 OS=Xenopus tropicalis GN=elavl2 PE=2 SV=2 308 498 1.0E-06
sp|Q8VC70|RBMS2_MOUSE RNA-binding motif, single-stranded-interacting protein 2 OS=Mus musculus GN=Rbms2 PE=1 SV=1 309 484 1.0E-06
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 315 484 2.0E-06
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 315 481 2.0E-06
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 315 481 2.0E-06
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 302 484 2.0E-06
sp|Q3ZBP3|RBMS1_BOVIN RNA-binding motif, single-stranded-interacting protein 1 OS=Bos taurus GN=RBMS1 PE=2 SV=1 309 484 2.0E-06
sp|Q8CGC6|RBM28_MOUSE RNA-binding protein 28 OS=Mus musculus GN=Rbm28 PE=1 SV=4 311 498 2.0E-06
sp|O80678|UBA2B_ARATH UBP1-associated protein 2B OS=Arabidopsis thaliana GN=UBA2B PE=2 SV=1 300 478 2.0E-06
sp|Q9WV25|PUF60_RAT Poly(U)-binding-splicing factor PUF60 OS=Rattus norvegicus GN=Puf60 PE=2 SV=2 315 480 2.0E-06
sp|Q3UEB3|PUF60_MOUSE Poly(U)-binding-splicing factor PUF60 OS=Mus musculus GN=Puf60 PE=1 SV=2 315 480 2.0E-06
sp|Q15056|IF4H_HUMAN Eukaryotic translation initiation factor 4H OS=Homo sapiens GN=EIF4H PE=1 SV=5 419 564 2.0E-06
sp|Q15434|RBMS2_HUMAN RNA-binding motif, single-stranded-interacting protein 2 OS=Homo sapiens GN=RBMS2 PE=1 SV=1 309 484 2.0E-06
sp|Q9UHX1|PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens GN=PUF60 PE=1 SV=1 315 480 2.0E-06
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 302 499 3.0E-06
sp|Q6PFR5|TRA2A_MOUSE Transformer-2 protein homolog alpha OS=Mus musculus GN=Tra2a PE=1 SV=1 284 397 3.0E-06
sp|Q13595|TRA2A_HUMAN Transformer-2 protein homolog alpha OS=Homo sapiens GN=TRA2A PE=1 SV=1 284 397 3.0E-06
sp|Q5R469|PUF60_PONAB Poly(U)-binding-splicing factor PUF60 OS=Pongo abelii GN=PUF60 PE=2 SV=1 315 480 3.0E-06
sp|P62997|TRA2B_RAT Transformer-2 protein homolog beta OS=Rattus norvegicus GN=Tra2b PE=1 SV=1 310 398 3.0E-06
sp|P62996|TRA2B_MOUSE Transformer-2 protein homolog beta OS=Mus musculus GN=Tra2b PE=1 SV=1 310 398 3.0E-06
sp|P62995|TRA2B_HUMAN Transformer-2 protein homolog beta OS=Homo sapiens GN=TRA2B PE=1 SV=1 310 398 3.0E-06
sp|Q3ZBT6|TRA2B_BOVIN Transformer-2 protein homolog beta OS=Bos taurus GN=TRA2B PE=2 SV=1 310 398 3.0E-06
sp|Q91W59|RBMS1_MOUSE RNA-binding motif, single-stranded-interacting protein 1 OS=Mus musculus GN=Rbms1 PE=1 SV=1 309 484 3.0E-06
sp|Q5PQP1|RBMS1_RAT RNA-binding motif, single-stranded-interacting protein 1 OS=Rattus norvegicus GN=Rbms1 PE=2 SV=1 309 484 3.0E-06
sp|P29558|RBMS1_HUMAN RNA-binding motif, single-stranded-interacting protein 1 OS=Homo sapiens GN=RBMS1 PE=1 SV=3 309 484 3.0E-06
sp|P98179|RBM3_HUMAN RNA-binding protein 3 OS=Homo sapiens GN=RBM3 PE=1 SV=1 413 498 4.0E-06
sp|F4I3B3|RB47A_ARATH Polyadenylate-binding protein RBP47A OS=Arabidopsis thaliana GN=RBP47A PE=2 SV=1 416 498 4.0E-06
sp|Q9LIS2|RBG4_ARATH Glycine-rich RNA-binding protein 4, mitochondrial OS=Arabidopsis thaliana GN=RBG4 PE=2 SV=1 420 504 4.0E-06
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 313 401 4.0E-06
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 313 401 4.0E-06
sp|Q8CH84|ELAV2_RAT ELAV-like protein 2 OS=Rattus norvegicus GN=Elavl2 PE=1 SV=1 341 498 4.0E-06
sp|Q14151|SAFB2_HUMAN Scaffold attachment factor B2 OS=Homo sapiens GN=SAFB2 PE=1 SV=1 259 408 4.0E-06
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 415 501 5.0E-06
sp|Q0CR95|PABP_ASPTN Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pab1 PE=3 SV=1 315 480 5.0E-06
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 302 484 5.0E-06
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 315 487 5.0E-06
sp|Q15427|SF3B4_HUMAN Splicing factor 3B subunit 4 OS=Homo sapiens GN=SF3B4 PE=1 SV=1 310 389 5.0E-06
sp|O75526|RMXL2_HUMAN RNA-binding motif protein, X-linked-like-2 OS=Homo sapiens GN=RBMXL2 PE=1 SV=3 315 386 5.0E-06
sp|Q96E39|RMXL1_HUMAN RNA binding motif protein, X-linked-like-1 OS=Homo sapiens GN=RBMXL1 PE=1 SV=1 315 389 5.0E-06
sp|Q8T6B9|PUF68_DROME Poly(U)-binding-splicing factor half pint OS=Drosophila melanogaster GN=pUf68 PE=1 SV=2 315 480 5.0E-06
sp|Q2HJG2|PUF60_BOVIN Poly(U)-binding-splicing factor PUF60 OS=Bos taurus GN=PUF60 PE=2 SV=1 315 480 5.0E-06
sp|P33240|CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens GN=CSTF2 PE=1 SV=1 419 498 5.0E-06
sp|Q8HXM1|CSTF2_BOVIN Cleavage stimulation factor subunit 2 OS=Bos taurus GN=CSTF2 PE=2 SV=1 419 498 5.0E-06
sp|Q5RDA3|CSTF2_PONAB Cleavage stimulation factor subunit 2 OS=Pongo abelii GN=CSTF2 PE=2 SV=1 419 498 5.0E-06
sp|Q6AYL5|SF3B4_RAT Splicing factor 3B subunit 4 OS=Rattus norvegicus GN=Sf3b4 PE=2 SV=1 310 389 6.0E-06
sp|Q8QZY9|SF3B4_MOUSE Splicing factor 3B subunit 4 OS=Mus musculus GN=Sf3b4 PE=1 SV=1 310 389 6.0E-06
sp|Q8HXM1|CSTF2_BOVIN Cleavage stimulation factor subunit 2 OS=Bos taurus GN=CSTF2 PE=2 SV=1 308 389 6.0E-06
sp|P19339|SXL_DROME Protein sex-lethal OS=Drosophila melanogaster GN=Sxl PE=1 SV=1 311 499 6.0E-06
sp|O43347|MSI1H_HUMAN RNA-binding protein Musashi homolog 1 OS=Homo sapiens GN=MSI1 PE=1 SV=1 315 501 6.0E-06
sp|P51990|RO22_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 2 OS=Xenopus laevis PE=2 SV=1 258 377 7.0E-06
sp|P33240|CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens GN=CSTF2 PE=1 SV=1 308 416 7.0E-06
sp|Q5RDA3|CSTF2_PONAB Cleavage stimulation factor subunit 2 OS=Pongo abelii GN=CSTF2 PE=2 SV=1 308 416 7.0E-06
sp|Q0WW84|RB47B_ARATH Polyadenylate-binding protein RBP47B OS=Arabidopsis thaliana GN=RBP47B PE=2 SV=1 314 501 8.0E-06
sp|O04319|PABP6_ARATH Polyadenylate-binding protein 6 OS=Arabidopsis thaliana GN=PAB6 PE=2 SV=1 314 484 8.0E-06
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 315 482 8.0E-06
sp|Q9WV02|RBMX_MOUSE RNA-binding motif protein, X chromosome OS=Mus musculus GN=Rbmx PE=1 SV=1 315 389 8.0E-06
sp|Q4V898|RBMX_RAT RNA-binding motif protein, X chromosome OS=Rattus norvegicus GN=Rbmx PE=1 SV=1 315 389 8.0E-06
sp|A5A6M3|RBMX_PANTR RNA-binding motif protein, X chromosome OS=Pan troglodytes GN=RBMX PE=2 SV=1 315 389 8.0E-06
sp|P38159|RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens GN=RBMX PE=1 SV=3 315 389 8.0E-06
sp|P07909|ROA1_DROME Heterogeneous nuclear ribonucleoprotein A1 OS=Drosophila melanogaster GN=Hrb98DE PE=2 SV=1 310 484 8.0E-06
sp|Q4R7F0|RBMX_MACFA RNA-binding motif protein, X chromosome OS=Macaca fascicularis GN=RBMX PE=2 SV=1 315 389 9.0E-06
sp|Q91VM5|RMXL1_MOUSE RNA binding motif protein, X-linked-like-1 OS=Mus musculus GN=Rbmxl1 PE=2 SV=1 315 389 9.0E-06
sp|Q28FX0|ELAV3_XENTR ELAV-like protein 3 OS=Xenopus tropicalis GN=elavl3 PE=2 SV=1 341 481 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5474
MAKSAESLKAVKRNGLEASKSRATVKDSVKIAPRKTPKSTEKPKKAKVSKPESSDESSEEEDPDSSEEDSSSESE
SSSDSDSEEEKPAVSKKAAANGKGKVAQSNLSETSESESEEEEKIKDKKKKPVVTAKAASNGKTKTAESSSSEDS
ESESEKEEKKKKKKKHSITTKATNGKAKTADSSSSEASDSESENGERKKKPVVTTKSSTNGKAKVTQPSSSEDSS
SESDSNGPEANGSEDESESSSGSESSDSESDEESDDVPTAEKSTSDGSDEVMGEVSDAAPVSKKRKAEAGDADVT
AKKTKTETDEASATLFVGGLSFDVDDKALYEAFEDYEGLVSARVIIDRMAQRSRGFGYVDFSDPDLASKAFEAMN
GQEVYGRYINLDYAQHRSADKPHQERAADRAKKHGDTVSPETDTLWVGNLPFGIDQDAVHKLFNDVCEVASIRLP
TDPETYEPKGFGYVSFKSVEDAKNAFQQLNGSSITAEGNTRNIRLDFAQPRPPREDGGFGGGRGGRGGRGGGRGF
GRGGGRGDFRGGGRGRGFGGGRGGDRGRGRGGRGAGSSYSGTKISFD*
Coding >OphauG2|5474
ATGGCCAAATCGGCCGAGTCGCTCAAGGCTGTCAAGAGAAATGGTTTGGAAGCTTCAAAGTCCAGAGCCACGGTC
AAAGACTCAGTCAAGATCGCGCCGAGAAAAACGCCCAAGTCCACGGAGAAGCCCAAGAAAGCAAAGGTTTCCAAG
CCCGAGTCTTCTGACGAGTCCTCTGAAGAAGAAGACCCTGATTCCTCAGAGGAGGACAGTTCGAGCGAATCCGAA
AGCTCTTCTGACTCTGATTCGGAGGAAGAGAAACCTGCTGTCTCCAAAAAAGCTGCAGCCAATGGCAAGGGCAAA
GTCGCGCAATCCAACCTATCGGAAACTTCTGAGTCCGAGTCGGAAGAAGAGGAGAAAATTAAGGATAAGAAGAAG
AAGCCCGTTGTTACCGCAAAGGCTGCTAGTAATGGCAAGACCAAGACGGCCGAGTCGAGCTCTTCAGAAGACTCC
GAGTCTGAGTCGGAAAAAGAGGAGAAGAAGAAGAAGAAGAAGAAGCACTCTATCACCACAAAGGCTACTAATGGC
AAGGCCAAAACTGCCGATTCTAGCTCTTCAGAAGCCTCTGATTCTGAGTCGGAAAACGGAGAGAGAAAAAAGAAG
CCCGTTGTCACTACAAAATCTTCTACAAATGGCAAGGCCAAGGTTACTCAGCCGAGCTCTTCTGAAGACTCCAGC
TCGGAGAGTGATTCTAATGGCCCTGAGGCCAACGGTTCCGAGGACGAGAGTGAATCATCGTCTGGCTCCGAATCA
TCAGATTCGGAGTCTGATGAAGAGAGCGACGATGTACCTACTGCCGAGAAATCTACATCTGACGGCTCGGATGAA
GTCATGGGCGAGGTGTCGGACGCCGCTCCCGTGTCTAAGAAACGCAAGGCAGAGGCTGGCGACGCCGACGTCACT
GCCAAGAAGACCAAGACGGAAACTGACGAGGCTTCTGCCACTCTTTTTGTCGGCGGCTTAAGCTTTGATGTGGAC
GACAAGGCTCTCTATGAGGCCTTTGAGGACTATGAGGGCCTTGTAAGCGCTCGTGTTATCATCGACAGGATGGCG
CAGCGCAGTCGCGGATTTGGCTACGTTGATTTCAGCGACCCTGATCTGGCCAGCAAGGCCTTTGAGGCTATGAAT
GGACAGGAAGTTTACGGTCGCTACATTAACCTTGATTACGCTCAACATCGCTCCGCTGATAAGCCTCATCAAGAA
CGGGCTGCTGACAGGGCCAAGAAGCACGGTGACACTGTTAGCCCCGAGACGGACACTTTGTGGGTTGGTAATCTG
CCTTTCGGCATCGACCAAGACGCTGTGCACAAATTGTTTAACGACGTCTGCGAGGTGGCTAGCATTCGACTGCCT
ACTGACCCTGAAACATATGAGCCCAAGGGCTTCGGCTATGTTTCCTTCAAGTCTGTCGAGGATGCCAAGAATGCA
TTCCAACAACTCAATGGATCTTCTATTACTGCAGAGGGTAACACGCGTAATATTCGTCTAGACTTTGCTCAGCCC
CGCCCTCCGCGGGAGGATGGTGGCTTTGGAGGGGGTCGTGGGGGCCGTGGAGGCCGTGGAGGCGGCCGTGGCTTC
GGTCGCGGTGGTGGTCGCGGTGATTTTCGCGGTGGTGGTCGCGGCCGTGGTTTCGGCGGCGGTCGTGGCGGCGAT
CGTGGCCGTGGCCGCGGTGGCCGTGGCGCTGGATCGAGTTACTCGGGAACCAAAATCTCCTTTGACTAG
Transcript >OphauG2|5474
ATGGCCAAATCGGCCGAGTCGCTCAAGGCTGTCAAGAGAAATGGTTTGGAAGCTTCAAAGTCCAGAGCCACGGTC
AAAGACTCAGTCAAGATCGCGCCGAGAAAAACGCCCAAGTCCACGGAGAAGCCCAAGAAAGCAAAGGTTTCCAAG
CCCGAGTCTTCTGACGAGTCCTCTGAAGAAGAAGACCCTGATTCCTCAGAGGAGGACAGTTCGAGCGAATCCGAA
AGCTCTTCTGACTCTGATTCGGAGGAAGAGAAACCTGCTGTCTCCAAAAAAGCTGCAGCCAATGGCAAGGGCAAA
GTCGCGCAATCCAACCTATCGGAAACTTCTGAGTCCGAGTCGGAAGAAGAGGAGAAAATTAAGGATAAGAAGAAG
AAGCCCGTTGTTACCGCAAAGGCTGCTAGTAATGGCAAGACCAAGACGGCCGAGTCGAGCTCTTCAGAAGACTCC
GAGTCTGAGTCGGAAAAAGAGGAGAAGAAGAAGAAGAAGAAGAAGCACTCTATCACCACAAAGGCTACTAATGGC
AAGGCCAAAACTGCCGATTCTAGCTCTTCAGAAGCCTCTGATTCTGAGTCGGAAAACGGAGAGAGAAAAAAGAAG
CCCGTTGTCACTACAAAATCTTCTACAAATGGCAAGGCCAAGGTTACTCAGCCGAGCTCTTCTGAAGACTCCAGC
TCGGAGAGTGATTCTAATGGCCCTGAGGCCAACGGTTCCGAGGACGAGAGTGAATCATCGTCTGGCTCCGAATCA
TCAGATTCGGAGTCTGATGAAGAGAGCGACGATGTACCTACTGCCGAGAAATCTACATCTGACGGCTCGGATGAA
GTCATGGGCGAGGTGTCGGACGCCGCTCCCGTGTCTAAGAAACGCAAGGCAGAGGCTGGCGACGCCGACGTCACT
GCCAAGAAGACCAAGACGGAAACTGACGAGGCTTCTGCCACTCTTTTTGTCGGCGGCTTAAGCTTTGATGTGGAC
GACAAGGCTCTCTATGAGGCCTTTGAGGACTATGAGGGCCTTGTAAGCGCTCGTGTTATCATCGACAGGATGGCG
CAGCGCAGTCGCGGATTTGGCTACGTTGATTTCAGCGACCCTGATCTGGCCAGCAAGGCCTTTGAGGCTATGAAT
GGACAGGAAGTTTACGGTCGCTACATTAACCTTGATTACGCTCAACATCGCTCCGCTGATAAGCCTCATCAAGAA
CGGGCTGCTGACAGGGCCAAGAAGCACGGTGACACTGTTAGCCCCGAGACGGACACTTTGTGGGTTGGTAATCTG
CCTTTCGGCATCGACCAAGACGCTGTGCACAAATTGTTTAACGACGTCTGCGAGGTGGCTAGCATTCGACTGCCT
ACTGACCCTGAAACATATGAGCCCAAGGGCTTCGGCTATGTTTCCTTCAAGTCTGTCGAGGATGCCAAGAATGCA
TTCCAACAACTCAATGGATCTTCTATTACTGCAGAGGGTAACACGCGTAATATTCGTCTAGACTTTGCTCAGCCC
CGCCCTCCGCGGGAGGATGGTGGCTTTGGAGGGGGTCGTGGGGGCCGTGGAGGCCGTGGAGGCGGCCGTGGCTTC
GGTCGCGGTGGTGGTCGCGGTGATTTTCGCGGTGGTGGTCGCGGCCGTGGTTTCGGCGGCGGTCGTGGCGGCGAT
CGTGGCCGTGGCCGCGGTGGCCGTGGCGCTGGATCGAGTTACTCGGGAACCAAAATCTCCTTTGACTAG
Gene >OphauG2|5474
ATGGCCAAATCGGCCGAGTCGCTCAAGGCTGTCAAGAGAAATGGTTTGGAAGCTTCAAAGTCCAGAGCCACGGTC
AAAGACTCAGTCAAGATCGCGCCGAGAAAAACGCCCAAGTCCACGGAGAAGCCCAAGAAAGCAAAGGTTTCCAAG
CCCGAGTCTTCTGACGAGTCCTCTGAAGAAGAAGACCCTGATTCCTCAGAGGAGGACAGTTCGAGCGAATCCGAA
AGCTCTTCTGACTCTGATTCGGAGGAAGAGAAACCTGCTGTCTCCAAAAAAGCTGCAGCCAATGGCAAGGGCAAA
GTCGCGCAATCCAACCTATCGGAAACTTCTGAGTCCGAGTCGGAAGAAGAGGAGAAAATTAAGGATAAGAAGAAG
AAGCCCGTTGTTACCGCAAAGGCTGCTAGTAATGGCAAGACCAAGACGGCCGAGTCGAGCTCTTCAGAAGACTCC
GAGTCTGAGTCGGAAAAAGAGGAGAAGAAGAAGAAGAAGAAGAAGCACTCTATCACCACAAAGGCTACTAATGGC
AAGGCCAAAACTGCCGATTCTAGCTCTTCAGAAGCCTCTGATTCTGAGTCGGAAAACGGAGAGAGAAAAAAGAAG
CCCGTTGTCACTACAAAATCTTCTACAAATGGCAAGGCCAAGGTTACTCAGCCGAGCTCTTCTGAAGACTCCAGC
TCGGAGAGTGATTCTAATGGCCCTGAGGCCAACGGTTCCGAGGACGAGAGTGAATCATCGTCTGGCTCCGAATCA
TCAGATTCGGAGTCTGATGAAGAGAGCGACGATGTACCTACTGCCGAGGTTTGTGGTTTTGACTTGGACTTTGTA
GTCTCAAACTCATTGTATTACAGAAATCTACATCTGACGGCTCGGATGAAGTCATGGGCGAGGTGTCGGACGCCG
CTCCCGTGTCTAAGAAACGCAAGGCAGAGGCTGGCGACGCCGACGTCACTGCCAAGAAGACCAAGACGGAAACTG
ACGAGGCTTCTGCCACTCTTTTTGTCGGCGGCTTAAGCTTTGATGTGGACGACAAGGCTCTCTATGAGGCCTTTG
AGGACTATGAGGGCCTTGTAAGCGCTCGTGTTATCATCGACAGGATGGCGCAGCGCAGTCGCGGATTTGGCTACG
TTGATTTCAGCGACCCTGATCTGGCCAGCAAGGCCTTTGAGGCTATGAATGGACAGGAAGTTTACGGTCGCTACA
TTAACCTTGATTACGCTCAACATCGCTCCGCTGATAAGCCTCATCAAGAACGGGCTGCTGACAGGGCCAAGAAGC
ACGGTGACACTGTTAGCCCCGAGACGGACACTTTGTGGGTTGGTAATCTGCCTTTCGGCATCGACCAAGACGCTG
TGCACAAATTGTTTAACGACGTCTGCGAGGTGGCTAGCATTCGACTGCCTACTGACCCGTGAGTTTGCTTTTGAC
CGATTCCCATGCAAAGATTTTCTGTATTGACTATTACGCAGTGAAACATATGAGCCCAAGGGCTTCGGCTATGTT
TCCTTCAAGTCTGTCGAGGATGCCAAGAATGCATTCCAACAACTCAATGGATCTTCTATTACTGCAGAGGGTAAC
ACGCGTAATATTCGTCTAGACTTTGCTCAGCCCCGCCCTCCGCGGGAGGATGGTGGCTTTGGAGGGGGTCGTGGG
GGCCGTGGAGGCCGTGGAGGCGGCCGTGGCTTCGGTCGCGGTGGTGGTCGCGGTGATTTTCGCGGTGGTGGTCGC
GGCCGTGGTTTCGGCGGCGGTCGTGGCGGCGATCGTGGCCGTGGCCGCGGTGGCCGTGGCGCTGGATCGAGTTAC
TCGGGAACCAAAATCTCCTTTGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail