Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5469
Gene name
LocationContig_503:8428..9443
Strand+
Gene length (bp)1015
Transcript length (bp)720
Coding sequence length (bp)720
Protein length (aa) 240

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02798 GST_N Glutathione S-transferase, N-terminal domain 6.0E-14 7 83
PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain 1.6E-11 9 88
PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain 3.8E-10 19 82
PF00043 GST_C Glutathione S-transferase, C-terminal domain 1.6E-05 139 195
PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain 1.0E-05 140 194

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P77526|YFCG_ECOLI Disulfide-bond oxidoreductase YfcG OS=Escherichia coli (strain K12) GN=yfcG PE=1 SV=1 7 196 3.0E-34
sp|Q46845|YGHU_ECOLI Disulfide-bond oxidoreductase YghU OS=Escherichia coli (strain K12) GN=yghU PE=1 SV=2 4 203 4.0E-32
sp|Q8NJR5|URE2_CANGA Protein URE2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=URE2 PE=3 SV=2 15 200 4.0E-31
sp|Q8NJR6|URE2_SACBA Protein URE2 OS=Saccharomyces bayanus GN=URE2 PE=3 SV=1 15 200 2.0E-30
sp|Q9Y7Q2|GST1_SCHPO Glutathione S-transferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gst1 PE=2 SV=1 15 196 5.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P77526|YFCG_ECOLI Disulfide-bond oxidoreductase YfcG OS=Escherichia coli (strain K12) GN=yfcG PE=1 SV=1 7 196 3.0E-34
sp|Q46845|YGHU_ECOLI Disulfide-bond oxidoreductase YghU OS=Escherichia coli (strain K12) GN=yghU PE=1 SV=2 4 203 4.0E-32
sp|Q8NJR5|URE2_CANGA Protein URE2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=URE2 PE=3 SV=2 15 200 4.0E-31
sp|Q8NJR6|URE2_SACBA Protein URE2 OS=Saccharomyces bayanus GN=URE2 PE=3 SV=1 15 200 2.0E-30
sp|Q9Y7Q2|GST1_SCHPO Glutathione S-transferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gst1 PE=2 SV=1 15 196 5.0E-30
sp|P23202|URE2_YEAST Transcriptional regulator URE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URE2 PE=1 SV=1 15 200 5.0E-30
sp|Q7LLZ8|URE2_SACPA Protein URE2 OS=Saccharomyces paradoxus GN=URE2 PE=3 SV=1 15 200 6.0E-30
sp|Q96WL3|URE2_CANAL Protein URE2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=URE2 PE=3 SV=1 13 200 5.0E-29
sp|Q8NJR2|URE2_ASHGO Protein URE2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=URE2 PE=3 SV=1 13 200 1.0E-28
sp|Q8NJR4|URE2_KLUMA Protein URE2 OS=Kluyveromyces marxianus GN=URE2 PE=3 SV=1 15 200 7.0E-28
sp|Q8NJR0|URE2_CANMA Protein URE2 OS=Candida maltosa GN=URE2 PE=3 SV=1 13 196 2.0E-27
sp|A5DDU4|URE2_PICGU Protein URE2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=URE2 PE=3 SV=2 13 196 2.0E-27
sp|Q6BM74|URE2_DEBHA Protein URE2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=URE2 PE=3 SV=2 13 196 4.0E-27
sp|Q96X43|URE2_KLULA Protein URE2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=URE2 PE=3 SV=1 15 200 8.0E-27
sp|Q8DTN7|Y1296_STRMU Uncharacterized GST-like protein SMU_1296 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=SMU_1296 PE=3 SV=1 7 203 4.0E-26
sp|Q555N6|Y4705_DICDI Glutathione S-transferase domain-containing protein DDB_G0274705 OS=Dictyostelium discoideum GN=DDB_G0274705 PE=3 SV=3 1 194 9.0E-26
sp|Q54UR0|Y0881_DICDI Glutathione S-transferase domain-containing protein DDB_G0280881 OS=Dictyostelium discoideum GN=DDB_G0280881 PE=3 SV=1 1 194 5.0E-25
sp|Q8SSU2|Y4223_DICDI Glutathione S-transferase domain-containing protein DDB_G0274223 OS=Dictyostelium discoideum GN=DDB_G0274223 PE=3 SV=1 1 194 8.0E-25
sp|O59827|GST2_SCHPO Glutathione S-transferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gst2 PE=2 SV=1 7 174 1.0E-21
sp|Q6R4B4|GST_ALTAL Glutathione-S-transferase OS=Alternaria alternata PE=1 SV=1 13 159 4.0E-13
sp|P04907|GSTF3_MAIZE Glutathione S-transferase 3 OS=Zea mays GN=GST3 PE=1 SV=4 14 199 2.0E-10
sp|P12653|GSTF1_MAIZE Glutathione S-transferase 1 OS=Zea mays GN=GST1 PE=1 SV=4 16 206 5.0E-09
sp|Q52828|GSTA_RHILE Protein GstA OS=Rhizobium leguminosarum GN=gstA PE=3 SV=1 19 197 6.0E-09
sp|O82451|GSTF2_ORYSJ Probable glutathione S-transferase GSTF2 OS=Oryza sativa subsp. japonica GN=GSTF2 PE=1 SV=3 16 199 1.0E-08
sp|O65857|GSTF1_ORYSJ Probable glutathione S-transferase GSTF1 OS=Oryza sativa subsp. japonica GN=GSTF1 PE=1 SV=2 16 209 1.0E-08
sp|Q9ZVQ4|GSTZ2_ARATH Glutathione S-transferase Z2 OS=Arabidopsis thaliana GN=GSTZ2 PE=3 SV=1 19 200 4.0E-08
sp|Q9VG93|GSTD7_DROME Glutathione S-transferase D7 OS=Drosophila melanogaster GN=GstD7 PE=1 SV=1 15 188 2.0E-07
sp|P30109|GSTF1_TOBAC Glutathione S-transferase PARB OS=Nicotiana tabacum GN=PARB PE=2 SV=1 18 200 3.0E-07
sp|P0ACA7|GSTB_ECOLI Glutathione S-transferase GstB OS=Escherichia coli (strain K12) GN=gstB PE=1 SV=1 37 205 4.0E-07
sp|P46440|GSTF2_TOBAC Glutathione S-transferase APIC OS=Nicotiana tabacum GN=APIC PE=2 SV=1 18 200 4.0E-07
sp|P0ACA8|GSTB_ECOL6 Glutathione S-transferase GstB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gstB PE=3 SV=1 37 205 4.0E-07
sp|P0ACA9|GSTB_SHIFL Glutathione S-transferase GstB OS=Shigella flexneri GN=gstB PE=3 SV=1 37 205 4.0E-07
sp|Q9VG97|GSTD3_DROME Inactive glutathione S-transferase D3 OS=Drosophila melanogaster GN=GstD3 PE=2 SV=1 27 200 5.0E-07
sp|Q9LZI9|GSTFD_ARATH Glutathione S-transferase F13 OS=Arabidopsis thaliana GN=GSTF13 PE=3 SV=1 19 199 2.0E-06
sp|Q9SLM6|GSTF3_ARATH Glutathione S-transferase F3 OS=Arabidopsis thaliana GN=GSTF3 PE=2 SV=1 19 199 2.0E-06
sp|Q9VG95|GSTD5_DROME Glutathione S-transferase D5 OS=Drosophila melanogaster GN=GstD5 PE=1 SV=2 16 187 3.0E-06
sp|P57109|MAAI_PSEAE Maleylacetoacetate isomerase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=maiA PE=3 SV=1 7 93 3.0E-06
sp|Q96266|GSTF8_ARATH Glutathione S-transferase F8, chloroplastic OS=Arabidopsis thaliana GN=GSTF8 PE=1 SV=3 18 199 5.0E-06
sp|P42761|GSTFA_ARATH Glutathione S-transferase F10 OS=Arabidopsis thaliana GN=GSTF10 PE=1 SV=3 7 170 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0006749 glutathione metabolic process Yes
GO:0003674 molecular_function No
GO:0043603 cellular amide metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006790 sulfur compound metabolic process No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0006518 peptide metabolic process No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009987 cellular process No
GO:0006575 cellular modified amino acid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5469
MATKTDITLYTVNTPNGIKVSILLAELGLDYKLRPIKFGENEQKEPWYLEINPNGRIPALTDKLADGRAMRAFES
GAALEYLVDRYDKEHRLSYPRDTPEHWEVTSWMGGLGPMQGQANHFQRYAPEKIEYGINRYVNETRRLYQTMETQ
LSKSQSGFLVGDRLTIADISCWGWVAAHYDFPNLEKWLTKLLERPGFEKGRHVPTPHTAFDKISEKEADKKAQEA
RAWIQDGMKKDAGK*
Coding >OphauG2|5469
ATGGCGACCAAGACGGACATTACCTTGTACACTGTAAACACGCCAAACGGCATCAAGGTGTCGATTTTGCTAGCT
GAGCTAGGACTCGACTACAAGCTGCGACCAATCAAGTTTGGTGAGAATGAGCAAAAGGAGCCATGGTATCTCGAA
ATCAATCCCAACGGGCGCATTCCGGCCCTGACGGACAAGCTGGCGGACGGACGGGCGATGCGAGCGTTTGAGAGC
GGGGCGGCGCTCGAGTACCTCGTCGACCGCTACGACAAGGAGCACCGGCTATCGTATCCACGCGACACACCCGAG
CACTGGGAGGTGACGAGCTGGATGGGAGGGCTGGGTCCGATGCAAGGACAGGCCAATCATTTTCAAAGATATGCA
CCAGAAAAGATTGAGTACGGCATCAACAGATATGTCAACGAGACGCGGCGTCTATACCAAACCATGGAAACACAG
CTTTCAAAGTCTCAATCTGGGTTCCTAGTCGGCGACCGCCTCACCATAGCCGATATTTCCTGCTGGGGATGGGTA
GCAGCACACTATGATTTCCCCAACTTGGAGAAATGGCTCACAAAGCTACTCGAGCGGCCTGGGTTTGAAAAGGGG
CGCCATGTGCCGACGCCGCACACGGCATTTGACAAGATTAGTGAAAAGGAGGCTGACAAGAAGGCGCAAGAGGCG
CGGGCGTGGATCCAGGACGGCATGAAGAAGGACGCGGGCAAATAA
Transcript >OphauG2|5469
ATGGCGACCAAGACGGACATTACCTTGTACACTGTAAACACGCCAAACGGCATCAAGGTGTCGATTTTGCTAGCT
GAGCTAGGACTCGACTACAAGCTGCGACCAATCAAGTTTGGTGAGAATGAGCAAAAGGAGCCATGGTATCTCGAA
ATCAATCCCAACGGGCGCATTCCGGCCCTGACGGACAAGCTGGCGGACGGACGGGCGATGCGAGCGTTTGAGAGC
GGGGCGGCGCTCGAGTACCTCGTCGACCGCTACGACAAGGAGCACCGGCTATCGTATCCACGCGACACACCCGAG
CACTGGGAGGTGACGAGCTGGATGGGAGGGCTGGGTCCGATGCAAGGACAGGCCAATCATTTTCAAAGATATGCA
CCAGAAAAGATTGAGTACGGCATCAACAGATATGTCAACGAGACGCGGCGTCTATACCAAACCATGGAAACACAG
CTTTCAAAGTCTCAATCTGGGTTCCTAGTCGGCGACCGCCTCACCATAGCCGATATTTCCTGCTGGGGATGGGTA
GCAGCACACTATGATTTCCCCAACTTGGAGAAATGGCTCACAAAGCTACTCGAGCGGCCTGGGTTTGAAAAGGGG
CGCCATGTGCCGACGCCGCACACGGCATTTGACAAGATTAGTGAAAAGGAGGCTGACAAGAAGGCGCAAGAGGCG
CGGGCGTGGATCCAGGACGGCATGAAGAAGGACGCGGGCAAATAA
Gene >OphauG2|5469
ATGGCGACCAAGACGGACATTACCTTGTACACTGTAAACACGCCAAACGGCATCAAGGTGTCGATTTTGCTAGCT
GAGCTAGGACTCGACTACAAGGTTTGAAATGACAAACTGGCCAAGCTCAAAAGACAAAAGGACAAAGAAGGCTCA
CCAAGCAAAACAATTGACAGCTGCGACCAATCAAGTTTGGTGAGAATGAGCAAAAGGAGCCATGGTATCTCGAAA
TCAATCCCAACGGGCGCATTCCGGCCCTGACGGACAAGCTGGCGGACGGACGGGCGATGCGAGCGTTTGAGAGCG
GGGCGGCGCTCGAGTACCTCGTCGACCGCTACGACAAGGAGCACCGGCTATCGTATCCACGCGACACACCCGAGC
ACTGGGAGGTGACGAGCTGGGTGAGTTGCAAGGGAAAGATGGTGATGATGATTGAGGGGTACTGACGCTGTGGTA
AGTTGATGTGGCAGATGGGAGGGCTGGGTCCGATGCAAGGACAGGCCAATCATTTTCAAAGTGAGCAACTTGAAT
GGGGCAGCAGTGGGAAGGAACAAGATTGTTAAAACATGGAGAGCAGGATATGCACCAGAAAAGATTGAGTACGGC
ATCAACAGATATGTCAACGAGACGCGGCGTCTATACCAAACCATGGAAACACAGCTTTCAAAGTCTCAATCTGGG
TTCCTAGTCGGCGACCGCCTCACCATAGCCGATATTTCCTGCTGGGGATGGGTAGCAGCACACTGTGAGTTTTTT
TTTTTTTCCCAATATATACACCAAAGTTTATTCAAGTATTGACATTTTTAAAAAAAAAGCGTGGGCGGGAATCAG
TCTAGATGATTTCCCCAACTTGGAGAAATGGCTCACAAAGCTACTCGAGCGGCCTGGGTTTGAAAAGGGGCGCCA
TGTGCCGACGCCGCACACGGCATTTGACAAGATTAGTGAAAAGGAGGCTGACAAGAAGGCGCAAGAGGCGCGGGC
GTGGATCCAGGACGGCATGAAGAAGGACGCGGGCAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail