Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5468
Gene name
LocationContig_503:5799..7785
Strand+
Gene length (bp)1986
Transcript length (bp)1869
Coding sequence length (bp)1869
Protein length (aa) 623

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00005 ABC_tran ABC transporter 9.4E-22 107 263
PF00005 ABC_tran ABC transporter 2.2E-21 420 552
PF12848 ABC_tran_Xtn ABC transporter 8.4E-22 303 377

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40024|ARB1_YEAST ABC transporter ATP-binding protein ARB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARB1 PE=1 SV=1 59 617 0.0E+00
sp|Q8T6B7|ABCF2_DICDI ABC transporter F family member 2 OS=Dictyostelium discoideum GN=abcF2 PE=3 SV=1 50 616 0.0E+00
sp|O42943|YBP8_SCHPO Uncharacterized ABC transporter ATP-binding protein C16H5.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16H5.08c PE=1 SV=1 3 618 0.0E+00
sp|Q9FJH6|AB1F_ARATH ABC transporter F family member 1 OS=Arabidopsis thaliana GN=ABCF1 PE=1 SV=1 58 615 0.0E+00
sp|Q99LE6|ABCF2_MOUSE ATP-binding cassette sub-family F member 2 OS=Mus musculus GN=Abcf2 PE=1 SV=1 20 617 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40024|ARB1_YEAST ABC transporter ATP-binding protein ARB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARB1 PE=1 SV=1 59 617 0.0E+00
sp|Q8T6B7|ABCF2_DICDI ABC transporter F family member 2 OS=Dictyostelium discoideum GN=abcF2 PE=3 SV=1 50 616 0.0E+00
sp|O42943|YBP8_SCHPO Uncharacterized ABC transporter ATP-binding protein C16H5.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16H5.08c PE=1 SV=1 3 618 0.0E+00
sp|Q9FJH6|AB1F_ARATH ABC transporter F family member 1 OS=Arabidopsis thaliana GN=ABCF1 PE=1 SV=1 58 615 0.0E+00
sp|Q99LE6|ABCF2_MOUSE ATP-binding cassette sub-family F member 2 OS=Mus musculus GN=Abcf2 PE=1 SV=1 20 617 0.0E+00
sp|Q9UG63|ABCF2_HUMAN ATP-binding cassette sub-family F member 2 OS=Homo sapiens GN=ABCF2 PE=1 SV=2 75 617 0.0E+00
sp|Q2KJA2|ABCF2_BOVIN ATP-binding cassette sub-family F member 2 OS=Bos taurus GN=ABCF2 PE=2 SV=1 20 617 0.0E+00
sp|Q9USH9|YJQ1_SCHPO Uncharacterized ABC transporter ATP-binding protein C825.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC825.01 PE=1 SV=1 18 616 3.0E-139
sp|Q8K268|ABCF3_MOUSE ATP-binding cassette sub-family F member 3 OS=Mus musculus GN=Abcf3 PE=1 SV=1 87 620 4.0E-134
sp|Q66H39|ABCF3_RAT ATP-binding cassette sub-family F member 3 OS=Rattus norvegicus GN=Abcf3 PE=2 SV=1 87 620 3.0E-133
sp|Q9NUQ8|ABCF3_HUMAN ATP-binding cassette sub-family F member 3 OS=Homo sapiens GN=ABCF3 PE=1 SV=2 87 620 5.0E-131
sp|Q5R9Z5|ABCF3_PONAB ATP-binding cassette sub-family F member 3 OS=Pongo abelii GN=ABCF3 PE=2 SV=1 87 620 3.0E-130
sp|Q9M1H3|AB4F_ARATH ABC transporter F family member 4 OS=Arabidopsis thaliana GN=ABCF4 PE=2 SV=1 88 616 5.0E-124
sp|Q8T6B4|ABCF4_DICDI ABC transporter F family member 4 OS=Dictyostelium discoideum GN=abcF4 PE=3 SV=1 89 616 9.0E-123
sp|O59672|YB89_SCHPO Uncharacterized ABC transporter ATP-binding protein C29A3.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A3.09c PE=3 SV=1 87 611 2.0E-121
sp|P43535|GCN20_YEAST Protein GCN20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN20 PE=1 SV=1 82 622 3.0E-120
sp|Q8H0V6|AB3F_ARATH ABC transporter F family member 3 OS=Arabidopsis thaliana GN=ABCF3 PE=1 SV=1 88 613 2.0E-116
sp|Q8NE71|ABCF1_HUMAN ATP-binding cassette sub-family F member 1 OS=Homo sapiens GN=ABCF1 PE=1 SV=2 82 622 5.0E-106
sp|Q767L0|ABCF1_PIG ATP-binding cassette sub-family F member 1 OS=Sus scrofa GN=ABCF1 PE=3 SV=1 82 622 1.0E-105
sp|Q6MG08|ABCF1_RAT ATP-binding cassette sub-family F member 1 OS=Rattus norvegicus GN=Abcf1 PE=1 SV=1 82 622 1.0E-105
sp|Q7YR37|ABCF1_PANTR ATP-binding cassette sub-family F member 1 OS=Pan troglodytes GN=ABCF1 PE=3 SV=1 82 622 2.0E-105
sp|Q6P542|ABCF1_MOUSE ATP-binding cassette sub-family F member 1 OS=Mus musculus GN=Abcf1 PE=1 SV=1 82 622 3.0E-103
sp|P63389|YHES_ECOLI Uncharacterized ABC transporter ATP-binding protein YheS OS=Escherichia coli (strain K12) GN=yheS PE=1 SV=1 102 612 6.0E-98
sp|P63390|YHES_ECO57 Uncharacterized ABC transporter ATP-binding protein YheS OS=Escherichia coli O157:H7 GN=yheS PE=3 SV=1 102 612 6.0E-98
sp|Q8SRV5|ABCF3_ENCCU Probable ATP-binding cassette sub-family F member 3 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU05_1190 PE=3 SV=1 97 609 1.0E-90
sp|P44808|Y658_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0658 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0658 PE=1 SV=1 104 615 1.0E-87
sp|P0A9U3|YBIT_ECOLI Uncharacterized ABC transporter ATP-binding protein YbiT OS=Escherichia coli (strain K12) GN=ybiT PE=1 SV=1 94 617 2.0E-75
sp|P0A9U4|YBIT_ECOL6 Uncharacterized ABC transporter ATP-binding protein YbiT OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ybiT PE=3 SV=1 94 617 2.0E-75
sp|P0A9U5|YBIT_ECO57 Uncharacterized ABC transporter ATP-binding protein YbiT OS=Escherichia coli O157:H7 GN=ybiT PE=3 SV=1 94 617 2.0E-75
sp|O05519|YDIF_BACSU Uncharacterized ABC transporter ATP-binding protein YdiF OS=Bacillus subtilis (strain 168) GN=ydiF PE=3 SV=2 99 615 1.0E-69
sp|Q9LV93|AB5F_ARATH ABC transporter F family member 5 OS=Arabidopsis thaliana GN=ABCF5 PE=2 SV=1 58 616 1.0E-63
sp|O31716|YKPA_BACSU Uncharacterized ABC transporter ATP-binding protein YkpA OS=Bacillus subtilis (strain 168) GN=ykpA PE=3 SV=1 90 591 2.0E-63
sp|Q9FIB4|AB2F_ARATH ABC transporter F family member 2 OS=Arabidopsis thaliana GN=ABCF2 PE=3 SV=2 68 616 4.0E-63
sp|O34512|YFMM_BACSU Uncharacterized ABC transporter ATP-binding protein YfmM OS=Bacillus subtilis (strain 168) GN=yfmM PE=3 SV=2 90 600 2.0E-57
sp|O06476|YFMR_BACSU Uncharacterized ABC transporter ATP-binding protein YfmR OS=Bacillus subtilis (strain 168) GN=yfmR PE=3 SV=1 102 614 3.0E-49
sp|P0A9W5|ETTA_SHIFL Energy-dependent translational throttle protein EttA OS=Shigella flexneri GN=ettA PE=3 SV=2 102 616 4.0E-47
sp|P0A9W3|ETTA_ECOLI Energy-dependent translational throttle protein EttA OS=Escherichia coli (strain K12) GN=ettA PE=1 SV=2 102 616 4.0E-47
sp|P0A9W4|ETTA_ECO57 Energy-dependent translational throttle protein EttA OS=Escherichia coli O157:H7 GN=ettA PE=3 SV=2 102 616 4.0E-47
sp|P43672|UUP_ECOLI ABC transporter ATP-binding protein uup OS=Escherichia coli (strain K12) GN=uup PE=1 SV=2 97 608 3.0E-46
sp|P45127|ETTA_HAEIN Energy-dependent translational throttle protein EttA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ettA PE=1 SV=1 102 621 3.0E-46
sp|P9WQK3|ETTA_MYCTU Energy-dependent translational throttle protein EttA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ettA PE=1 SV=1 100 610 4.0E-46
sp|P9WQK2|ETTA_MYCTO Energy-dependent translational throttle protein EttA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ettA PE=3 SV=1 100 610 4.0E-46
sp|Q08972|NEW1_YEAST [NU+] prion formation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEW1 PE=1 SV=1 90 508 2.0E-43
sp|O14134|ELF1_SCHPO mRNA export factor elf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=elf1 PE=1 SV=1 96 494 4.0E-43
sp|Q57242|UUP1_HAEIN ABC transporter ATP-binding protein uup-1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=uup-A PE=3 SV=1 90 596 6.0E-42
sp|P25256|TLRC_STRFR Tylosin resistance ATP-binding protein TlrC OS=Streptomyces fradiae GN=tlrC PE=3 SV=1 94 586 1.0E-39
sp|P39115|EXPZ_BACSU Nucleotide-binding protein ExpZ OS=Bacillus subtilis (strain 168) GN=expZ PE=3 SV=2 235 598 2.0E-39
sp|O93796|EF3_CANGA Elongation factor 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TEF3 PE=3 SV=2 96 508 1.0E-37
sp|P16521|EF3A_YEAST Elongation factor 3A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEF3 PE=1 SV=4 96 508 1.0E-35
sp|P57445|UUP_BUCAI ABC transporter ATP-binding protein uup OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=uup PE=3 SV=1 90 594 2.0E-35
sp|Q75EV6|EF3_ASHGO Elongation factor 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TEF3 PE=3 SV=2 96 508 2.0E-34
sp|P25997|EF3_CANAL Elongation factor 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CEF3 PE=1 SV=2 96 508 2.0E-34
sp|Q8K9I3|UUP_BUCAP ABC transporter ATP-binding protein uup OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=uup PE=3 SV=1 90 584 2.0E-34
sp|P53978|EF3B_YEAST Elongation factor 3B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEF3 PE=1 SV=2 96 508 3.0E-34
sp|O94489|EF3_SCHPO Elongation factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef3 PE=1 SV=1 96 508 5.0E-33
sp|P29551|EF3_PNECA Elongation factor 3 OS=Pneumocystis carinii GN=TEF3 PE=3 SV=1 59 473 1.0E-32
sp|P45167|UUP2_HAEIN ABC transporter ATP-binding protein uup-2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=uup-B PE=3 SV=1 267 594 2.0E-22
sp|P12622|CHVD_RHIRD ATP-binding protein ChvD (Fragment) OS=Rhizobium radiobacter GN=chvD PE=3 SV=1 235 469 2.0E-22
sp|P63389|YHES_ECOLI Uncharacterized ABC transporter ATP-binding protein YheS OS=Escherichia coli (strain K12) GN=yheS PE=1 SV=1 90 330 7.0E-21
sp|P63390|YHES_ECO57 Uncharacterized ABC transporter ATP-binding protein YheS OS=Escherichia coli O157:H7 GN=yheS PE=3 SV=1 90 330 7.0E-21
sp|P23212|MSRA_STAEP Erythromycin resistance ATP-binding protein MsrA OS=Staphylococcus epidermidis GN=msrA PE=3 SV=1 232 587 1.0E-20
sp|O34362|YKOD_BACSU Putative HMP/thiamine import ATP-binding protein YkoD OS=Bacillus subtilis (strain 168) GN=ykoD PE=1 SV=2 104 604 2.0E-20
sp|Q8PSR0|Y3016_METMA Putative ABC transporter ATP-binding protein MM_3016 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_3016 PE=3 SV=1 93 607 4.0E-20
sp|Q2SPI3|ZNUC1_HAHCH Zinc import ATP-binding protein ZnuC 1 OS=Hahella chejuensis (strain KCTC 2396) GN=znuC1 PE=3 SV=1 397 598 1.0E-17
sp|Q45978|HFAC_CAUCR Holdfast attachment protein C OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=hfaC PE=3 SV=2 399 618 1.0E-17
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 105 607 3.0E-17
sp|Q6FFL0|ZNUC_ACIAD Zinc import ATP-binding protein ZnuC OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=znuC PE=3 SV=1 393 612 9.0E-17
sp|Q6D4A8|ZNUC_PECAS Zinc import ATP-binding protein ZnuC OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=znuC PE=3 SV=1 400 604 9.0E-17
sp|P44808|Y658_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0658 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0658 PE=1 SV=1 104 372 1.0E-16
sp|O05519|YDIF_BACSU Uncharacterized ABC transporter ATP-binding protein YdiF OS=Bacillus subtilis (strain 168) GN=ydiF PE=3 SV=2 104 325 4.0E-16
sp|P0A9W5|ETTA_SHIFL Energy-dependent translational throttle protein EttA OS=Shigella flexneri GN=ettA PE=3 SV=2 414 615 1.0E-15
sp|P0A9W3|ETTA_ECOLI Energy-dependent translational throttle protein EttA OS=Escherichia coli (strain K12) GN=ettA PE=1 SV=2 414 615 1.0E-15
sp|P0A9W4|ETTA_ECO57 Energy-dependent translational throttle protein EttA OS=Escherichia coli O157:H7 GN=ettA PE=3 SV=2 414 615 1.0E-15
sp|Q45978|HFAC_CAUCR Holdfast attachment protein C OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=hfaC PE=3 SV=2 117 596 1.0E-15
sp|Q4FQ27|ZNUC_PSYA2 Zinc import ATP-binding protein ZnuC OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=znuC PE=3 SV=1 400 598 2.0E-15
sp|Q1Q889|ZNUC_PSYCK Zinc import ATP-binding protein ZnuC OS=Psychrobacter cryohalolentis (strain K5) GN=znuC PE=3 SV=2 400 598 2.0E-15
sp|Q32HA3|ZNUC_SHIDS Zinc import ATP-binding protein ZnuC OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=znuC PE=3 SV=1 400 604 3.0E-15
sp|Q83KR7|ZNUC_SHIFL Zinc import ATP-binding protein ZnuC OS=Shigella flexneri GN=znuC PE=3 SV=1 400 604 4.0E-15
sp|Q0T3U8|ZNUC_SHIF8 Zinc import ATP-binding protein ZnuC OS=Shigella flexneri serotype 5b (strain 8401) GN=znuC PE=3 SV=1 400 604 4.0E-15
sp|P46903|NATA_BACSU ABC transporter ATP-binding protein NatA OS=Bacillus subtilis (strain 168) GN=natA PE=1 SV=1 105 326 5.0E-15
sp|Q3Z2L6|ZNUC_SHISS Zinc import ATP-binding protein ZnuC OS=Shigella sonnei (strain Ss046) GN=znuC PE=3 SV=1 400 604 5.0E-15
sp|Q322E8|ZNUC_SHIBS Zinc import ATP-binding protein ZnuC OS=Shigella boydii serotype 4 (strain Sb227) GN=znuC PE=3 SV=1 400 604 5.0E-15
sp|Q1RAS6|ZNUC_ECOUT Zinc import ATP-binding protein ZnuC OS=Escherichia coli (strain UTI89 / UPEC) GN=znuC PE=3 SV=1 400 604 5.0E-15
sp|P0A9X1|ZNUC_ECOLI Zinc import ATP-binding protein ZnuC OS=Escherichia coli (strain K12) GN=znuC PE=1 SV=1 400 604 5.0E-15
sp|P0A9X2|ZNUC_ECOL6 Zinc import ATP-binding protein ZnuC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=znuC PE=3 SV=1 400 604 5.0E-15
sp|Q0TGX4|ZNUC_ECOL5 Zinc import ATP-binding protein ZnuC OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=znuC PE=3 SV=1 400 604 5.0E-15
sp|A1AC19|ZNUC_ECOK1 Zinc import ATP-binding protein ZnuC OS=Escherichia coli O1:K1 / APEC GN=znuC PE=3 SV=1 400 604 5.0E-15
sp|P0A9X3|ZNUC_ECO57 Zinc import ATP-binding protein ZnuC OS=Escherichia coli O157:H7 GN=znuC PE=3 SV=1 400 604 5.0E-15
sp|Q31I51|ZNUC_THICR Zinc import ATP-binding protein ZnuC OS=Thiomicrospira crunogena (strain XCL-2) GN=znuC PE=3 SV=1 399 596 8.0E-15
sp|Q8K9I3|UUP_BUCAP ABC transporter ATP-binding protein uup OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=uup PE=3 SV=1 399 615 1.0E-14
sp|P53978|EF3B_YEAST Elongation factor 3B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEF3 PE=1 SV=2 431 608 1.0E-14
sp|Q21PQ7|ZNUC_SACD2 Zinc import ATP-binding protein ZnuC OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=znuC PE=3 SV=1 399 613 1.0E-14
sp|O34512|YFMM_BACSU Uncharacterized ABC transporter ATP-binding protein YfmM OS=Bacillus subtilis (strain 168) GN=yfmM PE=3 SV=2 400 612 2.0E-14
sp|A1B9K8|ZNUC_PARDP Zinc import ATP-binding protein ZnuC OS=Paracoccus denitrificans (strain Pd 1222) GN=znuC PE=3 SV=1 399 604 2.0E-14
sp|Q93D97|Y1934_STRMU Putative ABC transporter ATP-binding protein SMU_1934c OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=sdcBA PE=3 SV=1 225 598 2.0E-14
sp|Q1IGY7|ZNUC_PSEE4 Zinc import ATP-binding protein ZnuC OS=Pseudomonas entomophila (strain L48) GN=znuC PE=3 SV=1 400 598 3.0E-14
sp|Q74I62|Y1704_LACJO Putative ABC transporter ATP-binding protein LJ_1704 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=LJ_1704 PE=3 SV=1 225 583 3.0E-14
sp|Q48PU6|METN1_PSE14 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=metN1 PE=3 SV=1 108 358 3.0E-14
sp|Q8Z5W6|ZNUC_SALTI Zinc import ATP-binding protein ZnuC OS=Salmonella typhi GN=znuC PE=3 SV=1 400 598 3.0E-14
sp|P39115|EXPZ_BACSU Nucleotide-binding protein ExpZ OS=Bacillus subtilis (strain 168) GN=expZ PE=3 SV=2 418 618 4.0E-14
sp|Q87UN0|ZNUC_PSESM Zinc import ATP-binding protein ZnuC OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=znuC PE=3 SV=1 400 598 4.0E-14
sp|Q4ZZR8|METN1_PSEU2 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=metN1 PE=3 SV=1 108 358 4.0E-14
sp|Q5PIA5|ZNUC_SALPA Zinc import ATP-binding protein ZnuC OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=znuC PE=3 SV=1 400 598 4.0E-14
sp|Q57NA5|ZNUC_SALCH Zinc import ATP-binding protein ZnuC OS=Salmonella choleraesuis (strain SC-B67) GN=znuC PE=3 SV=2 400 598 4.0E-14
sp|Q88RL1|ZNUC_PSEPK Zinc import ATP-binding protein ZnuC OS=Pseudomonas putida (strain KT2440) GN=znuC PE=3 SV=1 400 598 4.0E-14
sp|O94489|EF3_SCHPO Elongation factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef3 PE=1 SV=1 431 621 5.0E-14
sp|Q2FNX9|ECFA1_METHJ Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=ecfA1 PE=3 SV=1 400 607 7.0E-14
sp|Q0A9E2|ZNUC_ALKEH Zinc import ATP-binding protein ZnuC OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=znuC PE=3 SV=1 421 598 7.0E-14
sp|A1WXT0|ZNUC_HALHL Zinc import ATP-binding protein ZnuC OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=znuC PE=3 SV=1 399 611 8.0E-14
sp|A1JRI2|ZNUC_YERE8 Zinc import ATP-binding protein ZnuC OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=znuC PE=3 SV=1 434 598 9.0E-14
sp|Q5E6M2|ZNUC1_VIBF1 Zinc import ATP-binding protein ZnuC 1 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=znuC1 PE=3 SV=1 400 583 1.0E-13
sp|Q4KKK4|ZNUC_PSEF5 Zinc import ATP-binding protein ZnuC OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=znuC PE=3 SV=1 400 598 1.0E-13
sp|Q7N545|ZNUC_PHOLL Zinc import ATP-binding protein ZnuC OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=znuC PE=3 SV=2 418 604 1.0E-13
sp|Q48PV0|ZNUC_PSE14 Zinc import ATP-binding protein ZnuC OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=znuC PE=3 SV=1 400 598 1.0E-13
sp|Q87UN4|METN2_PSESM Methionine import ATP-binding protein MetN 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=metN2 PE=3 SV=1 108 358 2.0E-13
sp|A0KPH6|ZNUC_AERHH Zinc import ATP-binding protein ZnuC OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=znuC PE=3 SV=1 400 598 2.0E-13
sp|Q9HT73|ZNUC_PSEAE Zinc import ATP-binding protein ZnuC OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=znuC PE=3 SV=1 400 598 2.0E-13
sp|Q02DK9|ZNUC_PSEAB Zinc import ATP-binding protein ZnuC OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=znuC PE=3 SV=1 400 598 2.0E-13
sp|Q926D8|ZURA_LISIN Zinc uptake system ATP-binding protein ZurA OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=zurA PE=3 SV=1 400 612 2.0E-13
sp|Q57S53|METN2_SALCH Methionine import ATP-binding protein MetN 2 OS=Salmonella choleraesuis (strain SC-B67) GN=metN2 PE=3 SV=1 105 319 2.0E-13
sp|Q8ZR89|METN2_SALTY Methionine import ATP-binding protein MetN 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metN2 PE=3 SV=1 105 319 2.0E-13
sp|Q3KKA1|ZNUC_PSEPF Zinc import ATP-binding protein ZnuC OS=Pseudomonas fluorescens (strain Pf0-1) GN=znuC PE=3 SV=1 400 598 2.0E-13
sp|Q6D3Q6|METN2_PECAS Methionine import ATP-binding protein MetN 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN2 PE=3 SV=1 105 335 2.0E-13
sp|P44692|ZNUC_HAEIN Zinc import ATP-binding protein ZnuC OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=znuC PE=3 SV=1 399 598 2.0E-13
sp|Q1GL85|ZNUC_RUEST Zinc import ATP-binding protein ZnuC OS=Ruegeria sp. (strain TM1040) GN=znuC PE=3 SV=1 400 598 2.0E-13
sp|Q8ZNV7|ZNUC_SALTY Zinc import ATP-binding protein ZnuC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=znuC PE=2 SV=2 400 598 2.0E-13
sp|O93796|EF3_CANGA Elongation factor 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TEF3 PE=3 SV=2 431 608 3.0E-13
sp|Q75EV6|EF3_ASHGO Elongation factor 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TEF3 PE=3 SV=2 431 608 3.0E-13
sp|Q7MMN0|ZNUC_VIBVY Zinc import ATP-binding protein ZnuC OS=Vibrio vulnificus (strain YJ016) GN=znuC PE=3 SV=1 432 583 3.0E-13
sp|Q8DFQ4|ZNUC_VIBVU Zinc import ATP-binding protein ZnuC OS=Vibrio vulnificus (strain CMCP6) GN=znuC PE=3 SV=1 432 583 3.0E-13
sp|Q2RS22|NIKE_RHORT Nickel import ATP-binding protein NikE OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=nikE PE=3 SV=1 80 302 3.0E-13
sp|Q4QND5|ZNUC_HAEI8 Zinc import ATP-binding protein ZnuC OS=Haemophilus influenzae (strain 86-028NP) GN=znuC PE=3 SV=1 394 598 3.0E-13
sp|Q8Z8R5|METN2_SALTI Methionine import ATP-binding protein MetN 2 OS=Salmonella typhi GN=metN2 PE=3 SV=1 105 319 3.0E-13
sp|Q1CJG3|ZNUC_YERPN Zinc import ATP-binding protein ZnuC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=znuC PE=3 SV=1 398 598 3.0E-13
sp|Q7CIC2|ZNUC_YERPE Zinc import ATP-binding protein ZnuC OS=Yersinia pestis GN=znuC PE=3 SV=1 398 598 3.0E-13
sp|Q1C812|ZNUC_YERPA Zinc import ATP-binding protein ZnuC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=znuC PE=3 SV=1 398 598 3.0E-13
sp|Q3SQ65|HMUV_NITWN Hemin import ATP-binding protein HmuV OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=hmuV PE=3 SV=1 399 598 3.0E-13
sp|Q92G36|ZNUC_RICCN Zinc import ATP-binding protein ZnuC OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=znuC PE=3 SV=1 399 598 3.0E-13
sp|Q66AT7|ZNUC_YERPS Zinc import ATP-binding protein ZnuC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=znuC PE=3 SV=1 398 598 3.0E-13
sp|Q72D73|Y1056_DESVH Putative ABC transporter ATP-binding protein DVU_1056 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=DVU_1056 PE=3 SV=1 399 600 4.0E-13
sp|Q6HG98|Y3105_BACHK Putative ABC transporter ATP-binding protein BT9727_3105 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=BT9727_3105 PE=3 SV=1 109 592 4.0E-13
sp|P37774|YECC_ECOLI L-cystine transport system ATP-binding protein YecC OS=Escherichia coli (strain K12) GN=yecC PE=3 SV=2 99 307 5.0E-13
sp|Q4UJW5|ZNUC_RICFE Zinc import ATP-binding protein ZnuC OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=znuC PE=3 SV=1 399 598 5.0E-13
sp|Q4KKK8|METN1_PSEF5 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=metN1 PE=3 SV=1 108 344 6.0E-13
sp|Q4ZZS2|ZNUC_PSEU2 Zinc import ATP-binding protein ZnuC OS=Pseudomonas syringae pv. syringae (strain B728a) GN=znuC PE=3 SV=1 400 598 6.0E-13
sp|Q9XDA6|ZURA_LISMO Zinc uptake system ATP-binding protein ZurA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=zurA PE=3 SV=1 400 612 6.0E-13
sp|O31716|YKPA_BACSU Uncharacterized ABC transporter ATP-binding protein YkpA OS=Bacillus subtilis (strain 168) GN=ykpA PE=3 SV=1 400 604 7.0E-13
sp|Q89AJ0|ZNUC_BUCBP Zinc import ATP-binding protein ZnuC OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=znuC PE=3 SV=1 401 598 7.0E-13
sp|Q5PCG9|METN2_SALPA Methionine import ATP-binding protein MetN 2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metN2 PE=3 SV=1 105 319 7.0E-13
sp|P25256|TLRC_STRFR Tylosin resistance ATP-binding protein TlrC OS=Streptomyces fradiae GN=tlrC PE=3 SV=1 397 612 8.0E-13
sp|Q8RI39|POTA_FUSNN Spermidine/putrescine import ATP-binding protein PotA OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=potA PE=3 SV=1 88 266 8.0E-13
sp|Q3IWB5|ZNUC_RHOS4 Zinc import ATP-binding protein ZnuC OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=znuC PE=3 SV=1 416 604 9.0E-13
sp|Q5LUR8|ZNUC_RUEPO Zinc import ATP-binding protein ZnuC OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=znuC PE=3 SV=1 399 604 9.0E-13
sp|P45127|ETTA_HAEIN Energy-dependent translational throttle protein EttA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ettA PE=1 SV=1 88 321 1.0E-12
sp|Q04FM1|ECFA2_OENOB Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=ecfA2 PE=3 SV=1 105 292 1.0E-12
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 342 598 1.0E-12
sp|Q3KK97|METN1_PSEPF Methionine import ATP-binding protein MetN 1 OS=Pseudomonas fluorescens (strain Pf0-1) GN=metN1 PE=3 SV=1 108 358 1.0E-12
sp|Q88RL5|METN1_PSEPK Methionine import ATP-binding protein MetN 1 OS=Pseudomonas putida (strain KT2440) GN=metN1 PE=3 SV=1 108 358 1.0E-12
sp|Q18C09|METN_PEPD6 Methionine import ATP-binding protein MetN OS=Peptoclostridium difficile (strain 630) GN=metN PE=3 SV=1 99 313 1.0E-12
sp|P39115|EXPZ_BACSU Nucleotide-binding protein ExpZ OS=Bacillus subtilis (strain 168) GN=expZ PE=3 SV=2 90 339 2.0E-12
sp|Q5L222|POTA_GEOKA Spermidine/putrescine import ATP-binding protein PotA OS=Geobacillus kaustophilus (strain HTA426) GN=potA PE=3 SV=1 99 319 2.0E-12
sp|Q4L5B3|POTA_STAHJ Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=potA PE=3 SV=1 99 319 2.0E-12
sp|Q9HT70|METN2_PSEAE Methionine import ATP-binding protein MetN 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=metN2 PE=3 SV=1 108 358 2.0E-12
sp|Q02DK6|METN2_PSEAB Methionine import ATP-binding protein MetN 2 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=metN2 PE=3 SV=1 108 358 2.0E-12
sp|Q81N53|Y3364_BACAN Putative ABC transporter ATP-binding protein BA_3364/GBAA_3364/BAS3118 OS=Bacillus anthracis GN=BA_3364 PE=3 SV=1 109 592 2.0E-12
sp|Q9ZCC4|ZNUC_RICPR Zinc import ATP-binding protein ZnuC OS=Rickettsia prowazekii (strain Madrid E) GN=znuC PE=3 SV=1 399 598 2.0E-12
sp|Q0KDG3|METN_CUPNH Methionine import ATP-binding protein MetN OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=metN PE=3 SV=1 105 298 2.0E-12
sp|Q217B2|HMUV_RHOPB Hemin import ATP-binding protein HmuV OS=Rhodopseudomonas palustris (strain BisB18) GN=hmuV PE=3 SV=1 401 592 2.0E-12
sp|Q65UG3|ZNUC_MANSM Zinc import ATP-binding protein ZnuC OS=Mannheimia succiniciproducens (strain MBEL55E) GN=znuC PE=3 SV=2 399 598 2.0E-12
sp|Q3YW48|NIKE_SHISS Nickel import ATP-binding protein NikE OS=Shigella sonnei (strain Ss046) GN=nikE PE=3 SV=1 99 304 3.0E-12
sp|Q1LQF6|METN_CUPMC Methionine import ATP-binding protein MetN OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=metN PE=3 SV=1 105 347 3.0E-12
sp|P33594|NIKE_ECOLI Nickel import ATP-binding protein NikE OS=Escherichia coli (strain K12) GN=nikE PE=3 SV=2 99 304 3.0E-12
sp|Q8CRI7|ECFA2_STAES Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ecfA2 PE=3 SV=1 105 292 3.0E-12
sp|Q895C4|METN_CLOTE Methionine import ATP-binding protein MetN OS=Clostridium tetani (strain Massachusetts / E88) GN=metN PE=3 SV=1 98 358 3.0E-12
sp|Q1IGZ0|METN2_PSEE4 Methionine import ATP-binding protein MetN 2 OS=Pseudomonas entomophila (strain L48) GN=metN2 PE=3 SV=1 108 358 3.0E-12
sp|Q68Y13|ZNUC_RICTY Zinc import ATP-binding protein ZnuC OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=znuC PE=3 SV=1 429 598 3.0E-12
sp|Q9KQB8|ZNUC_VIBCH Zinc import ATP-binding protein ZnuC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=znuC PE=3 SV=1 421 612 4.0E-12
sp|Q8DFC3|METN_VIBVU Methionine import ATP-binding protein MetN OS=Vibrio vulnificus (strain CMCP6) GN=metN PE=3 SV=1 107 325 4.0E-12
sp|Q7MN25|METN_VIBVY Methionine import ATP-binding protein MetN OS=Vibrio vulnificus (strain YJ016) GN=metN PE=3 SV=1 107 325 4.0E-12
sp|Q5HM28|ECFA2_STAEQ Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ecfA2 PE=3 SV=1 105 292 4.0E-12
sp|Q9GTN7|TAGA_DICDI Serine protease/ABC transporter B family protein tagA OS=Dictyostelium discoideum GN=tagA PE=1 SV=2 401 578 5.0E-12
sp|Q72D73|Y1056_DESVH Putative ABC transporter ATP-binding protein DVU_1056 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=DVU_1056 PE=3 SV=1 108 302 6.0E-12
sp|P23212|MSRA_STAEP Erythromycin resistance ATP-binding protein MsrA OS=Staphylococcus epidermidis GN=msrA PE=3 SV=1 96 310 7.0E-12
sp|Q2G9A9|CCMA_NOVAD Cytochrome c biogenesis ATP-binding export protein CcmA OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=ccmA PE=3 SV=1 418 586 7.0E-12
sp|Q32AQ1|NIKE_SHIDS Nickel import ATP-binding protein NikE OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=nikE PE=3 SV=1 104 304 7.0E-12
sp|Q87RE5|ZNUC_VIBPA Zinc import ATP-binding protein ZnuC OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=znuC PE=3 SV=1 421 612 8.0E-12
sp|Q6LTB1|ZNUC_PHOPR Zinc import ATP-binding protein ZnuC OS=Photobacterium profundum GN=znuC PE=3 SV=1 432 583 9.0E-12
sp|Q3J1N0|METN_RHOS4 Methionine import ATP-binding protein MetN OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=metN PE=3 SV=1 105 330 9.0E-12
sp|Q87RS1|METN_VIBPA Methionine import ATP-binding protein MetN OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=metN PE=1 SV=1 107 325 9.0E-12
sp|P16521|EF3A_YEAST Elongation factor 3A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEF3 PE=1 SV=4 431 608 1.0E-11
sp|Q92N13|HMUV_RHIME Hemin import ATP-binding protein HmuV OS=Rhizobium meliloti (strain 1021) GN=hmuV PE=3 SV=1 405 619 1.0E-11
sp|Q8D385|ZNUC_WIGBR Zinc import ATP-binding protein ZnuC OS=Wigglesworthia glossinidia brevipalpis GN=znuC PE=3 SV=1 407 611 1.0E-11
sp|Q1R5D8|NIKE_ECOUT Nickel import ATP-binding protein NikE OS=Escherichia coli (strain UTI89 / UPEC) GN=nikE PE=3 SV=1 104 304 1.0E-11
sp|Q8FCM9|NIKE_ECOL6 Nickel import ATP-binding protein NikE OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nikE PE=3 SV=1 104 304 1.0E-11
sp|Q0TBX8|NIKE_ECOL5 Nickel import ATP-binding protein NikE OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=nikE PE=3 SV=1 104 304 1.0E-11
sp|Q6D664|LOLD_PECAS Lipoprotein-releasing system ATP-binding protein LolD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=lolD PE=3 SV=1 104 310 1.0E-11
sp|Q6F0V4|POTA_MESFL Spermidine/putrescine import ATP-binding protein PotA OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=potA PE=3 SV=1 99 321 2.0E-11
sp|P33311|MDL2_YEAST ATP-dependent permease MDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL2 PE=1 SV=3 400 610 2.0E-11
sp|Q6D5H7|METN1_PECAS Methionine import ATP-binding protein MetN 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN1 PE=3 SV=1 105 337 2.0E-11
sp|Q8NSN2|METN_CORGL Methionine import ATP-binding protein MetN OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metN PE=3 SV=1 107 351 2.0E-11
sp|Q46RX0|CCMA_CUPPJ Cytochrome c biogenesis ATP-binding export protein CcmA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ccmA PE=3 SV=1 399 583 2.0E-11
sp|P33916|YEJF_ECOLI Uncharacterized ABC transporter ATP-binding protein YejF OS=Escherichia coli (strain K12) GN=yejF PE=3 SV=1 103 305 2.0E-11
sp|P0A2V2|OCCP_RHIRD Octopine permease ATP-binding protein P OS=Rhizobium radiobacter GN=occP PE=2 SV=1 98 343 2.0E-11
sp|P0A2V3|OCCP_AGRT4 Octopine permease ATP-binding protein P OS=Agrobacterium tumefaciens (strain Ach5) GN=occP PE=3 SV=1 98 343 2.0E-11
sp|P31134|POTG_ECOLI Putrescine transport ATP-binding protein PotG OS=Escherichia coli (strain K12) GN=potG PE=3 SV=2 99 383 2.0E-11
sp|Q8RFN2|METN_FUSNN Methionine import ATP-binding protein MetN OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=metN PE=3 SV=1 105 338 2.0E-11
sp|Q0B6I6|METN2_BURCM Methionine import ATP-binding protein MetN 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metN2 PE=3 SV=1 58 301 3.0E-11
sp|D5AQY6|NIKO_RHOCB Nickel import ATP-binding protein NikO OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=nikO PE=1 SV=1 110 322 3.0E-11
sp|P50332|NODI_RHIGA Nod factor export ATP-binding protein I OS=Rhizobium galegae GN=nodI PE=3 SV=1 67 347 3.0E-11
sp|Q6FAN3|METN1_ACIAD Methionine import ATP-binding protein MetN 1 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metN1 PE=3 SV=1 107 302 3.0E-11
sp|Q5RKI8|ABCB8_RAT ATP-binding cassette sub-family B member 8, mitochondrial OS=Rattus norvegicus GN=Abcb8 PE=2 SV=1 401 619 3.0E-11
sp|P29551|EF3_PNECA Elongation factor 3 OS=Pneumocystis carinii GN=TEF3 PE=3 SV=1 421 608 4.0E-11
sp|Q9CP24|ZNUC_PASMU Zinc import ATP-binding protein ZnuC OS=Pasteurella multocida (strain Pm70) GN=znuC PE=3 SV=1 399 598 4.0E-11
sp|Q7VLS9|ZNUC_HAEDU Zinc import ATP-binding protein ZnuC OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=znuC PE=3 SV=1 405 598 4.0E-11
sp|Q160Y9|ZNUC_ROSDO Zinc import ATP-binding protein ZnuC OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=znuC PE=3 SV=1 434 604 4.0E-11
sp|Q07LU3|HMUV_RHOP5 Hemin import ATP-binding protein HmuV OS=Rhodopseudomonas palustris (strain BisA53) GN=hmuV PE=3 SV=1 401 592 4.0E-11
sp|Q9JI39|ABCBA_MOUSE ATP-binding cassette sub-family B member 10, mitochondrial OS=Mus musculus GN=Abcb10 PE=1 SV=1 401 578 4.0E-11
sp|Q31VE6|NIKE_SHIBS Nickel import ATP-binding protein NikE OS=Shigella boydii serotype 4 (strain Sb227) GN=nikE PE=3 SV=1 104 304 5.0E-11
sp|Q5HBR8|ZNUC_EHRRW Zinc import ATP-binding protein ZnuC OS=Ehrlichia ruminantium (strain Welgevonden) GN=znuC PE=3 SV=1 400 598 5.0E-11
sp|Q5FHB0|ZNUC_EHRRG Zinc import ATP-binding protein ZnuC OS=Ehrlichia ruminantium (strain Gardel) GN=znuC PE=3 SV=1 400 598 5.0E-11
sp|Q0VTB6|ZNUC_ALCBS Zinc import ATP-binding protein ZnuC OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=znuC PE=3 SV=1 396 598 5.0E-11
sp|Q1RGL1|ZNUC_RICBR Zinc import ATP-binding protein ZnuC OS=Rickettsia bellii (strain RML369-C) GN=znuC PE=3 SV=1 399 598 5.0E-11
sp|Q6G4Q8|Y276_BARHE Putative ABC transporter ATP-binding protein BH02760 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=BH02760 PE=3 SV=1 400 614 5.0E-11
sp|Q5HQ70|POTA_STAEQ Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=potA PE=3 SV=1 104 319 5.0E-11
sp|Q15TB1|LOLD_PSEA6 Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=lolD PE=3 SV=1 400 590 5.0E-11
sp|Q160M2|POTA_ROSDO Spermidine/putrescine import ATP-binding protein PotA OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=potA PE=3 SV=1 118 339 5.0E-11
sp|Q2Y624|LOLD_NITMU Lipoprotein-releasing system ATP-binding protein LolD OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=lolD PE=3 SV=1 410 590 5.0E-11
sp|Q6LN52|METN_PHOPR Methionine import ATP-binding protein MetN OS=Photobacterium profundum GN=metN PE=3 SV=2 105 325 5.0E-11
sp|P25997|EF3_CANAL Elongation factor 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CEF3 PE=1 SV=2 429 608 6.0E-11
sp|Q6G1D9|Y270_BARQU Putative ABC transporter ATP-binding protein BQ02700 OS=Bartonella quintana (strain Toulouse) GN=BQ02700 PE=3 SV=1 400 614 6.0E-11
sp|Q7MFH3|Y4347_VIBVY Putative ABC transporter ATP-binding protein VVA0347 OS=Vibrio vulnificus (strain YJ016) GN=VVA0347 PE=3 SV=1 225 598 7.0E-11
sp|Q8UA86|RBSA1_AGRFC Ribose import ATP-binding protein RbsA 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rbsA1 PE=3 SV=2 75 556 7.0E-11
sp|Q46Y69|METN_CUPPJ Methionine import ATP-binding protein MetN OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=metN PE=3 SV=1 105 325 7.0E-11
sp|Q70GD4|HMUV_PHODP Hemin import ATP-binding protein HmuV OS=Photobacterium damsela subsp. piscicida GN=hmuV PE=3 SV=1 418 604 7.0E-11
sp|P0C0E2|SRTF_STRPY Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes GN=srtF PE=3 SV=1 418 604 7.0E-11
sp|P0C0E3|SRTF_STRP1 Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes serotype M1 GN=srtF PE=3 SV=1 418 604 7.0E-11
sp|Q8X4L6|NIKE_ECO57 Nickel import ATP-binding protein NikE OS=Escherichia coli O157:H7 GN=nikE PE=3 SV=1 104 304 8.0E-11
sp|Q8UCM5|HMUV_AGRFC Hemin import ATP-binding protein HmuV OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=hmuV PE=3 SV=1 434 622 9.0E-11
sp|Q6GEL4|ECFA2_STAAR Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain MRSA252) GN=ecfA2 PE=3 SV=1 400 598 9.0E-11
sp|O32169|METN_BACSU Methionine import ATP-binding protein MetN OS=Bacillus subtilis (strain 168) GN=metN PE=1 SV=1 400 595 9.0E-11
sp|Q7NTU0|LOLD_CHRVO Lipoprotein-releasing system ATP-binding protein LolD OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=lolD PE=3 SV=1 110 293 9.0E-11
sp|O34946|ZNUC_BACSU High-affinity zinc uptake system ATP-binding protein ZnuC OS=Bacillus subtilis (strain 168) GN=znuC PE=1 SV=1 400 588 1.0E-10
sp|Q2YYM5|ECFA2_STAAB Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ecfA2 PE=3 SV=1 401 598 1.0E-10
sp|Q14Q07|POTA_SPICI Spermidine/putrescine import ATP-binding protein PotA OS=Spiroplasma citri GN=potA PE=3 SV=1 99 321 1.0E-10
sp|Q1CFH7|METN2_YERPN Methionine import ATP-binding protein MetN 2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=metN2 PE=3 SV=1 105 298 1.0E-10
sp|Q8ZH38|METN1_YERPE Methionine import ATP-binding protein MetN 1 OS=Yersinia pestis GN=metN1 PE=3 SV=1 105 298 1.0E-10
sp|Q1CAK4|METN1_YERPA Methionine import ATP-binding protein MetN 1 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=metN1 PE=3 SV=1 105 298 1.0E-10
sp|Q51719|YCOBA_PROFR Putative ABC transporter ATP-binding protein in cobA 5'region OS=Propionibacterium freudenreichii subsp. shermanii PE=3 SV=1 400 594 1.0E-10
sp|Q667L9|METN2_YERPS Methionine import ATP-binding protein MetN 2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=metN2 PE=3 SV=1 105 298 1.0E-10
sp|Q7A088|ECFA2_STAAW Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain MW2) GN=ecfA2 PE=3 SV=1 401 598 1.0E-10
sp|Q6G7A0|ECFA2_STAAS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain MSSA476) GN=ecfA2 PE=3 SV=1 401 598 1.0E-10
sp|Q7A471|ECFA2_STAAN Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain N315) GN=ecfA2 PE=1 SV=1 401 598 1.0E-10
sp|Q99S48|ECFA2_STAAM Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ecfA2 PE=3 SV=1 401 598 1.0E-10
sp|Q5HDY7|ECFA2_STAAC Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain COL) GN=ecfA2 PE=3 SV=1 401 598 1.0E-10
sp|Q2FW35|ECFA2_STAA8 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain NCTC 8325) GN=ecfA2 PE=3 SV=1 401 598 1.0E-10
sp|Q2FER8|ECFA2_STAA3 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain USA300) GN=ecfA2 PE=3 SV=1 401 598 1.0E-10
sp|Q166I9|CCMA_ROSDO Cytochrome c biogenesis ATP-binding export protein CcmA OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ccmA PE=3 SV=1 401 578 1.0E-10
sp|P45022|Y1078_HAEIN Probable amino-acid ABC transporter ATP-binding protein HI_1078 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1078 PE=3 SV=1 99 304 1.0E-10
sp|Q0I5E9|METN_HAES1 Methionine import ATP-binding protein MetN OS=Haemophilus somnus (strain 129Pt) GN=metN PE=3 SV=1 107 324 1.0E-10
sp|Q8ETV6|ECFA2_OCEIH Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=ecfA2 PE=3 SV=1 105 292 1.0E-10
sp|Q3YSK9|ZNUC_EHRCJ Zinc import ATP-binding protein ZnuC OS=Ehrlichia canis (strain Jake) GN=znuC PE=3 SV=2 400 598 1.0E-10
sp|P43672|UUP_ECOLI ABC transporter ATP-binding protein uup OS=Escherichia coli (strain K12) GN=uup PE=1 SV=2 78 327 2.0E-10
sp|Q6GEL4|ECFA2_STAAR Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain MRSA252) GN=ecfA2 PE=3 SV=1 105 305 2.0E-10
sp|Q8ELQ6|METN3_OCEIH Methionine import ATP-binding protein MetN 3 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=metN3 PE=3 SV=1 105 339 2.0E-10
sp|Q832Y6|METN1_ENTFA Methionine import ATP-binding protein MetN 1 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=metN1 PE=3 SV=1 406 613 2.0E-10
sp|Q0S0X2|SSUB3_RHOJR Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Rhodococcus jostii (strain RHA1) GN=ssuB3 PE=3 SV=1 373 595 2.0E-10
sp|Q659V4|HMUV_PHODD Hemin import ATP-binding protein HmuV OS=Photobacterium damselae subsp. damselae GN=hmuV PE=3 SV=1 418 604 2.0E-10
sp|Q1J255|HMUV_DEIGD Hemin import ATP-binding protein HmuV OS=Deinococcus geothermalis (strain DSM 11300) GN=hmuV PE=3 SV=1 396 592 2.0E-10
sp|O57896|WTPC_PYRHO Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=wtpC PE=3 SV=1 111 326 2.0E-10
sp|Q24QI5|METN_DESHY Methionine import ATP-binding protein MetN OS=Desulfitobacterium hafniense (strain Y51) GN=metN PE=3 SV=1 103 299 2.0E-10
sp|P45092|ARTP_HAEIN Arginine transport ATP-binding protein ArtP OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=artP PE=3 SV=1 107 334 2.0E-10
sp|Q8XHV2|ECFA1_CLOPE Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Clostridium perfringens (strain 13 / Type A) GN=ecfA1 PE=3 SV=1 102 292 2.0E-10
sp|Q0TMS7|ECFA1_CLOP1 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ecfA1 PE=3 SV=1 102 292 2.0E-10
sp|Q83J77|NIKE_SHIFL Nickel import ATP-binding protein NikE OS=Shigella flexneri GN=nikE PE=3 SV=1 102 304 2.0E-10
sp|Q2SSS4|POTA_MYCCT Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=potA PE=3 SV=1 99 321 2.0E-10
sp|Q8CRI7|ECFA2_STAES Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ecfA2 PE=3 SV=1 401 598 3.0E-10
sp|Q5HM28|ECFA2_STAEQ Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ecfA2 PE=3 SV=1 401 598 3.0E-10
sp|Q6D664|LOLD_PECAS Lipoprotein-releasing system ATP-binding protein LolD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=lolD PE=3 SV=1 412 590 3.0E-10
sp|Q734T1|Y3323_BACC1 Putative ABC transporter ATP-binding protein BCE_3323 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_3323 PE=3 SV=1 213 592 3.0E-10
sp|Q6MU19|POTA_MYCMS Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=potA PE=3 SV=1 99 321 3.0E-10
sp|Q1IGN4|METN1_PSEE4 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas entomophila (strain L48) GN=metN1 PE=3 SV=1 110 325 3.0E-10
sp|Q1MAL7|CCMA_RHIL3 Cytochrome c biogenesis ATP-binding export protein CcmA OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ccmA PE=3 SV=1 413 577 3.0E-10
sp|Q6F9A8|CYSA_ACIAD Sulfate/thiosulfate import ATP-binding protein CysA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=cysA PE=3 SV=1 99 321 3.0E-10
sp|Q8CPN0|POTA_STAES Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=potA PE=3 SV=1 104 319 3.0E-10
sp|Q92LX3|METN_RHIME Methionine import ATP-binding protein MetN OS=Rhizobium meliloti (strain 1021) GN=metN PE=3 SV=1 107 326 3.0E-10
sp|Q8P2K6|METN_STRP8 Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=metN PE=3 SV=1 105 319 3.0E-10
sp|Q88UV2|METN2_LACPL Methionine import ATP-binding protein MetN 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=metN2 PE=3 SV=1 400 594 3.0E-10
sp|Q39AT4|METN2_BURL3 Methionine import ATP-binding protein MetN 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=metN2 PE=3 SV=1 105 301 3.0E-10
sp|A0LCH8|ZNUC_MAGMM Zinc import ATP-binding protein ZnuC OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=znuC PE=3 SV=1 421 598 4.0E-10
sp|Q8FRX8|METN_COREF Methionine import ATP-binding protein MetN OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=metN PE=3 SV=1 103 319 4.0E-10
sp|Q1JNE0|METN_STRPC Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=metN PE=3 SV=1 105 319 4.0E-10
sp|Q1JDG6|METN_STRPB Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=metN PE=3 SV=1 105 319 4.0E-10
sp|Q1R4I3|RBSA_ECOUT Ribose import ATP-binding protein RbsA OS=Escherichia coli (strain UTI89 / UPEC) GN=rbsA PE=3 SV=1 99 592 4.0E-10
sp|Q5XDS8|METN_STRP6 Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=metN PE=3 SV=1 105 319 4.0E-10
sp|Q2GFZ6|ZNUC_EHRCR Zinc import ATP-binding protein ZnuC OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=znuC PE=3 SV=1 400 598 4.0E-10
sp|Q57399|Y1470_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1470 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1470 PE=1 SV=1 401 619 4.0E-10
sp|Q13LD8|METN2_BURXL Methionine import ATP-binding protein MetN 2 OS=Burkholderia xenovorans (strain LB400) GN=metN2 PE=3 SV=1 105 301 4.0E-10
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 343 578 5.0E-10
sp|Q7NIW1|CYSA_GLOVI Sulfate/thiosulfate import ATP-binding protein CysA OS=Gloeobacter violaceus (strain PCC 7421) GN=cysA PE=3 SV=1 105 324 5.0E-10
sp|Q82VL9|LOLD_NITEU Lipoprotein-releasing system ATP-binding protein LolD OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=lolD PE=3 SV=1 400 585 5.0E-10
sp|Q03A07|METN_LACC3 Methionine import ATP-binding protein MetN OS=Lactobacillus casei (strain ATCC 334) GN=metN PE=3 SV=1 99 304 5.0E-10
sp|A1TXH7|POTA_MARHV Spermidine/putrescine import ATP-binding protein PotA OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=potA PE=3 SV=1 99 321 5.0E-10
sp|Q4L884|ECFA2_STAHJ Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ecfA2 PE=3 SV=1 401 598 5.0E-10
sp|Q6F9P2|METN2_ACIAD Methionine import ATP-binding protein MetN 2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metN2 PE=3 SV=1 110 298 5.0E-10
sp|Q831K6|METN2_ENTFA Methionine import ATP-binding protein MetN 2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=metN2 PE=1 SV=1 400 594 5.0E-10
sp|P04983|RBSA_ECOLI Ribose import ATP-binding protein RbsA OS=Escherichia coli (strain K12) GN=rbsA PE=1 SV=1 99 592 5.0E-10
sp|Q0TAW0|RBSA_ECOL5 Ribose import ATP-binding protein RbsA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rbsA PE=3 SV=1 99 592 5.0E-10
sp|Q53I83|METN_STRGR Methionine import ATP-binding protein MetN OS=Streptomyces griseus GN=metN PE=3 SV=2 110 305 5.0E-10
sp|Q0SZJ3|NIKE_SHIF8 Nickel import ATP-binding protein NikE OS=Shigella flexneri serotype 5b (strain 8401) GN=nikE PE=3 SV=1 104 304 5.0E-10
sp|P57445|UUP_BUCAI ABC transporter ATP-binding protein uup OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=uup PE=3 SV=1 427 615 6.0E-10
sp|Q9S4Z0|METN_SALEN Methionine import ATP-binding protein MetN OS=Salmonella enteritidis GN=metN PE=3 SV=1 122 319 6.0E-10
sp|P0CZ31|METN_STRPQ Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=metN PE=3 SV=1 105 319 6.0E-10
sp|P0CZ30|METN_STRP3 Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=metN PE=3 SV=1 105 319 6.0E-10
sp|A3DJK5|ECFA2_CLOTH Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=ecfA2 PE=3 SV=1 406 598 6.0E-10
sp|P72297|OCCP_RHIML Octopine permease ATP-binding protein P OS=Rhizobium meliloti GN=occP PE=3 SV=1 98 325 6.0E-10
sp|Q47YG8|LOLD_COLP3 Lipoprotein-releasing system ATP-binding protein LolD OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=lolD PE=3 SV=1 104 295 6.0E-10
sp|A0B344|METN2_BURCH Methionine import ATP-binding protein MetN 2 OS=Burkholderia cenocepacia (strain HI2424) GN=metN2 PE=3 SV=1 105 301 6.0E-10
sp|Q1BR30|METN2_BURCA Methionine import ATP-binding protein MetN 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=metN2 PE=3 SV=1 105 301 6.0E-10
sp|Q0SQH5|ECFA1_CLOPS Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Clostridium perfringens (strain SM101 / Type A) GN=ecfA1 PE=3 SV=1 102 292 6.0E-10
sp|Q7A088|ECFA2_STAAW Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain MW2) GN=ecfA2 PE=3 SV=1 105 305 7.0E-10
sp|Q6G7A0|ECFA2_STAAS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain MSSA476) GN=ecfA2 PE=3 SV=1 105 305 7.0E-10
sp|Q7A471|ECFA2_STAAN Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain N315) GN=ecfA2 PE=1 SV=1 105 305 7.0E-10
sp|Q99S48|ECFA2_STAAM Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ecfA2 PE=3 SV=1 105 305 7.0E-10
sp|Q5HDY7|ECFA2_STAAC Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain COL) GN=ecfA2 PE=3 SV=1 105 305 7.0E-10
sp|Q2FW35|ECFA2_STAA8 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain NCTC 8325) GN=ecfA2 PE=3 SV=1 105 305 7.0E-10
sp|Q2FER8|ECFA2_STAA3 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain USA300) GN=ecfA2 PE=3 SV=1 105 305 7.0E-10
sp|Q48V78|METN_STRPM Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=metN PE=3 SV=1 105 319 7.0E-10
sp|Q9A1E3|METN_STRP1 Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M1 GN=metN PE=3 SV=1 105 319 7.0E-10
sp|Q1M7W6|NODI_RHIL3 Nod factor export ATP-binding protein I OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=nodI PE=3 SV=2 396 555 7.0E-10
sp|P48334|YCXD_CYAPA Probable ABC transporter ATP-binding protein in ycf23-apcF intergenic region OS=Cyanophora paradoxa PE=3 SV=1 398 580 7.0E-10
sp|Q0TJC1|SSUB_ECOL5 Aliphatic sulfonates import ATP-binding protein SsuB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ssuB PE=3 SV=1 401 598 7.0E-10
sp|Q0T5R2|POTA_SHIF8 Spermidine/putrescine import ATP-binding protein PotA OS=Shigella flexneri serotype 5b (strain 8401) GN=potA PE=3 SV=1 90 324 7.0E-10
sp|Q1J8E4|METN_STRPF Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=metN PE=3 SV=1 97 319 7.0E-10
sp|P23212|MSRA_STAEP Erythromycin resistance ATP-binding protein MsrA OS=Staphylococcus epidermidis GN=msrA PE=3 SV=1 431 603 8.0E-10
sp|Q92UV5|FBPC2_RHIME Fe(3+) ions import ATP-binding protein FbpC 2 OS=Rhizobium meliloti (strain 1021) GN=fbpC2 PE=3 SV=1 105 345 8.0E-10
sp|Q9CXJ4|ABCB8_MOUSE ATP-binding cassette sub-family B member 8, mitochondrial OS=Mus musculus GN=Abcb8 PE=1 SV=1 401 619 8.0E-10
sp|Q2NU23|LOLD_SODGM Lipoprotein-releasing system ATP-binding protein LolD OS=Sodalis glossinidius (strain morsitans) GN=lolD PE=3 SV=1 399 590 8.0E-10
sp|Q0BSM2|LOLD_GRABC Lipoprotein-releasing system ATP-binding protein LolD OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=lolD PE=3 SV=1 397 598 8.0E-10
sp|Q043Y8|METN_LACGA Methionine import ATP-binding protein MetN OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=metN PE=3 SV=1 105 305 8.0E-10
sp|Q04EY4|ECFA3_OENOB Energy-coupling factor transporter ATP-binding protein EcfA3 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=ecfA3 PE=3 SV=1 401 615 8.0E-10
sp|Q8K9M6|ZNUC_BUCAP Zinc import ATP-binding protein ZnuC OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=znuC PE=3 SV=1 400 604 8.0E-10
sp|Q2YYM5|ECFA2_STAAB Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ecfA2 PE=3 SV=1 105 305 9.0E-10
sp|Q0I4A9|ZNUC_HAES1 Zinc import ATP-binding protein ZnuC OS=Haemophilus somnus (strain 129Pt) GN=znuC PE=3 SV=1 393 598 9.0E-10
sp|Q93SH7|HMUV_BRADU Hemin import ATP-binding protein HmuV OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hmuV PE=3 SV=1 432 592 9.0E-10
sp|Q7A169|POTA_STAAW Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain MW2) GN=potA PE=3 SV=1 115 319 9.0E-10
sp|Q6GAB5|POTA_STAAS Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain MSSA476) GN=potA PE=3 SV=1 115 319 9.0E-10
sp|Q6GHY6|POTA_STAAR Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain MRSA252) GN=potA PE=3 SV=1 115 319 9.0E-10
sp|Q7A679|POTA_STAAN Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain N315) GN=potA PE=1 SV=1 115 319 9.0E-10
sp|Q99V03|POTA_STAAM Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=potA PE=3 SV=1 115 319 9.0E-10
sp|Q5HGY5|POTA_STAAC Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain COL) GN=potA PE=3 SV=1 115 319 9.0E-10
sp|Q2YX74|POTA_STAAB Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=potA PE=3 SV=1 115 319 9.0E-10
sp|Q2G2A7|POTA_STAA8 Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain NCTC 8325) GN=potA PE=3 SV=1 115 319 9.0E-10
sp|Q2FHY1|POTA_STAA3 Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus aureus (strain USA300) GN=potA PE=3 SV=1 115 319 9.0E-10
sp|Q928L8|METN2_LISIN Methionine import ATP-binding protein MetN 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=metN2 PE=3 SV=1 400 612 9.0E-10
sp|Q1M7W6|NODI_RHIL3 Nod factor export ATP-binding protein I OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=nodI PE=3 SV=2 99 298 1.0E-09
sp|Q04EY4|ECFA3_OENOB Energy-coupling factor transporter ATP-binding protein EcfA3 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=ecfA3 PE=3 SV=1 105 292 1.0E-09
sp|Q2W8B4|PSTB1_MAGSA Phosphate import ATP-binding protein PstB 1 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=pstB1 PE=3 SV=1 107 291 1.0E-09
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 432 592 1.0E-09
sp|Q080S4|LOLD_SHEFN Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella frigidimarina (strain NCIMB 400) GN=lolD PE=3 SV=1 410 590 1.0E-09
sp|Q9HPH7|Y1631_HALSA Putative ABC transporter ATP-binding protein VNG_1631G OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=VNG_1631G PE=3 SV=1 432 598 1.0E-09
sp|Q5WDP1|METN3_BACSK Methionine import ATP-binding protein MetN 3 OS=Bacillus clausii (strain KSM-K16) GN=metN3 PE=3 SV=1 421 598 1.0E-09
sp|Q32EY4|POTA_SHIDS Spermidine/putrescine import ATP-binding protein PotA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=potA PE=3 SV=1 90 324 1.0E-09
sp|Q1MQ44|POTA_LAWIP Spermidine/putrescine import ATP-binding protein PotA OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=potA PE=3 SV=1 90 292 1.0E-09
sp|P08720|NODI_RHILV Nod factor export ATP-binding protein I OS=Rhizobium leguminosarum bv. viciae GN=nodI PE=3 SV=1 396 555 1.0E-09
sp|Q8T6J0|ABCA7_DICDI ABC transporter A family member 7 OS=Dictyostelium discoideum GN=abcA7 PE=3 SV=1 410 593 1.0E-09
sp|Q3M5J9|SSUB_ANAVT Aliphatic sulfonates import ATP-binding protein SsuB OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=ssuB PE=3 SV=1 80 292 1.0E-09
sp|Q49ZD9|ECFA2_STAS1 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ecfA2 PE=3 SV=1 110 292 1.0E-09
sp|Q5QXD0|HMUV_IDILO Hemin import ATP-binding protein HmuV OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=hmuV PE=3 SV=1 421 610 1.0E-09
sp|Q0BMC9|METN_FRATO Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=metN PE=3 SV=1 103 342 1.0E-09
sp|Q2A3Z2|METN_FRATH Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. holarctica (strain LVS) GN=metN PE=3 SV=1 103 342 1.0E-09
sp|Q65VG9|METN_MANSM Methionine import ATP-binding protein MetN OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metN PE=3 SV=1 107 325 1.0E-09
sp|Q2W4W1|ZNUC_MAGSA Zinc import ATP-binding protein ZnuC OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=znuC PE=3 SV=1 400 612 1.0E-09
sp|Q1GS38|CCMA_SPHAL Cytochrome c biogenesis ATP-binding export protein CcmA OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=ccmA PE=3 SV=1 418 591 1.0E-09
sp|P77737|OPPF_ECOLI Oligopeptide transport ATP-binding protein OppF OS=Escherichia coli (strain K12) GN=oppF PE=3 SV=1 109 336 1.0E-09
sp|Q5WBL0|SSUB3_BACSK Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Bacillus clausii (strain KSM-K16) GN=ssuB3 PE=3 SV=1 415 598 1.0E-09
sp|Q52666|BZTD_RHOCB Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=bztD PE=3 SV=2 99 325 1.0E-09
sp|P95487|CCMA_PSEPG Cytochrome c biogenesis ATP-binding export protein CcmA OS=Pseudomonas putida (strain GB-1) GN=ccmA PE=3 SV=3 418 577 1.0E-09
sp|Q5PMK1|POTA_SALPA Spermidine/putrescine import ATP-binding protein PotA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=potA PE=3 SV=1 99 324 1.0E-09
sp|P9WQL6|FLQE1_MYCTO Fluoroquinolones export ATP-binding protein MT2762 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2762 PE=3 SV=1 400 602 1.0E-09
sp|Q3A9G5|METN_CARHZ Methionine import ATP-binding protein MetN OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=metN PE=3 SV=1 105 298 1.0E-09
sp|P40790|POTA_SALTY Spermidine/putrescine import ATP-binding protein PotA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=potA PE=3 SV=2 99 324 1.0E-09
sp|Q57QC8|POTA_SALCH Spermidine/putrescine import ATP-binding protein PotA OS=Salmonella choleraesuis (strain SC-B67) GN=potA PE=3 SV=1 99 324 1.0E-09
sp|Q2SJK0|LOLD_HAHCH Lipoprotein-releasing system ATP-binding protein LolD OS=Hahella chejuensis (strain KCTC 2396) GN=lolD PE=3 SV=1 399 589 1.0E-09
sp|Q4FTM3|LOLD_PSYA2 Lipoprotein-releasing system ATP-binding protein LolD OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=lolD PE=3 SV=1 104 319 1.0E-09
sp|Q7MKU3|POTA_VIBVY Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio vulnificus (strain YJ016) GN=potA PE=3 SV=2 90 324 1.0E-09
sp|Q8D9J4|POTA_VIBVU Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio vulnificus (strain CMCP6) GN=potA PE=3 SV=1 90 324 1.0E-09
sp|Q8Z7H7|POTA_SALTI Spermidine/putrescine import ATP-binding protein PotA OS=Salmonella typhi GN=potA PE=3 SV=1 99 324 1.0E-09
sp|Q1MMZ3|PHNC_RHIL3 Phosphonates import ATP-binding protein PhnC OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=phnC PE=3 SV=2 101 313 2.0E-09
sp|Q7N0N3|Y3849_PHOLL Putative ABC transporter ATP-binding protein plu3849 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=plu3849 PE=3 SV=1 400 583 2.0E-09
sp|Q2VYP7|PSTB3_MAGSA Phosphate import ATP-binding protein PstB 3 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=pstB3 PE=3 SV=1 84 291 2.0E-09
sp|Q2IF17|LOLD_ANADE Lipoprotein-releasing system ATP-binding protein LolD OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=lolD PE=3 SV=1 110 289 2.0E-09
sp|Q6NJ07|METN_CORDI Methionine import ATP-binding protein MetN OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=metN PE=3 SV=1 109 334 2.0E-09
sp|Q83CV2|LOLD_COXBU Lipoprotein-releasing system ATP-binding protein LolD OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=lolD PE=3 SV=1 399 592 2.0E-09
sp|Q7UX73|LOLD1_RHOBA Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=lolD1 PE=3 SV=1 110 293 2.0E-09
sp|Q8U648|SSUB2_AGRFC Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ssuB2 PE=3 SV=2 99 292 2.0E-09
sp|Q97JB8|Y1368_CLOAB Putative ABC transporter ATP-binding protein CA_C1368 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1368 PE=3 SV=1 107 353 2.0E-09
sp|Q1RDS4|SSUB_ECOUT Aliphatic sulfonates import ATP-binding protein SsuB OS=Escherichia coli (strain UTI89 / UPEC) GN=ssuB PE=3 SV=1 401 598 2.0E-09
sp|Q8FJ95|SSUB_ECOL6 Aliphatic sulfonates import ATP-binding protein SsuB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ssuB PE=3 SV=1 401 598 2.0E-09
sp|A1A9L0|SSUB_ECOK1 Aliphatic sulfonates import ATP-binding protein SsuB OS=Escherichia coli O1:K1 / APEC GN=ssuB PE=3 SV=1 401 598 2.0E-09
sp|Q8RHK9|ECFA2_FUSNN Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=ecfA2 PE=3 SV=1 105 328 2.0E-09
sp|Q12NL5|LOLD_SHEDO Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=lolD PE=3 SV=1 410 590 2.0E-09
sp|Q9KL04|MALK_VIBCH Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=malK PE=3 SV=1 100 289 2.0E-09
sp|Q1RD28|POTA_ECOUT Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli (strain UTI89 / UPEC) GN=potA PE=3 SV=1 90 324 2.0E-09
sp|A1AA20|POTA_ECOK1 Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli O1:K1 / APEC GN=potA PE=3 SV=1 90 324 2.0E-09
sp|Q9HZS1|HISP_PSEAE Histidine transport ATP-binding protein HisP OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hisP PE=3 SV=1 128 326 2.0E-09
sp|P9WQL7|FLQE1_MYCTU Fluoroquinolones export ATP-binding protein Rv2688c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2688c PE=1 SV=1 400 602 2.0E-09
sp|Q8Y4L8|METN2_LISMO Methionine import ATP-binding protein MetN 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=metN2 PE=3 SV=1 400 595 2.0E-09
sp|P69877|POTA_SHIFL Spermidine/putrescine import ATP-binding protein PotA OS=Shigella flexneri GN=potA PE=3 SV=1 90 324 2.0E-09
sp|P69874|POTA_ECOLI Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli (strain K12) GN=potA PE=1 SV=1 90 324 2.0E-09
sp|P69875|POTA_ECOL6 Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=potA PE=3 SV=1 90 324 2.0E-09
sp|Q0TIU8|POTA_ECOL5 Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=potA PE=3 SV=1 90 324 2.0E-09
sp|P69876|POTA_ECO57 Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli O157:H7 GN=potA PE=3 SV=1 90 324 2.0E-09
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 344 598 2.0E-09
sp|Q8Z8W8|PHNT_SALTI Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella typhi GN=phnT PE=3 SV=1 77 289 2.0E-09
sp|Q3KFY6|CCMA_PSEPF Cytochrome c biogenesis ATP-binding export protein CcmA OS=Pseudomonas fluorescens (strain Pf0-1) GN=ccmA PE=3 SV=1 418 577 3.0E-09
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 401 578 3.0E-09
sp|Q3Z2Z3|POTA_SHISS Spermidine/putrescine import ATP-binding protein PotA OS=Shigella sonnei (strain Ss046) GN=potA PE=3 SV=1 90 324 3.0E-09
sp|Q31ZK0|POTA_SHIBS Spermidine/putrescine import ATP-binding protein PotA OS=Shigella boydii serotype 4 (strain Sb227) GN=potA PE=3 SV=1 90 324 3.0E-09
sp|Q6LR20|POTA_PHOPR Spermidine/putrescine import ATP-binding protein PotA OS=Photobacterium profundum GN=potA PE=3 SV=1 82 372 3.0E-09
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 401 613 3.0E-09
sp|Q1QCN2|LOLD_PSYCK Lipoprotein-releasing system ATP-binding protein LolD OS=Psychrobacter cryohalolentis (strain K5) GN=lolD PE=3 SV=1 104 319 3.0E-09
sp|Q2FRT7|ECFA2_METHJ Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=ecfA2 PE=3 SV=1 399 598 3.0E-09
sp|P45052|OPPD_HAEIN Oligopeptide transport ATP-binding protein OppD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=oppD PE=3 SV=1 105 323 3.0E-09
sp|Q55740|Y385_SYNY3 Putative ABC transporter ATP-binding protein sll0385 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0385 PE=3 SV=1 90 302 3.0E-09
sp|Q1JII9|METN_STRPD Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=metN PE=3 SV=1 105 319 3.0E-09
sp|Q8GEH7|METN_ERWPE Methionine import ATP-binding protein MetN OS=Erwinia pyrifoliae (strain Ep1/96) GN=metN PE=3 SV=1 433 598 3.0E-09
sp|O52618|NODI_RHIME Nod factor export ATP-binding protein I OS=Rhizobium meliloti (strain 1021) GN=nodI PE=3 SV=3 399 555 3.0E-09
sp|Q1R155|ZNUC_CHRSD Zinc import ATP-binding protein ZnuC OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=znuC PE=3 SV=2 421 598 3.0E-09
sp|P0A2V9|PSTB3_STRR6 Phosphate import ATP-binding protein PstB 3 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pstB3 PE=1 SV=1 119 291 3.0E-09
sp|P0A2V8|PSTB3_STRPN Phosphate import ATP-binding protein PstB 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pstB3 PE=3 SV=1 119 291 3.0E-09
sp|Q97KS6|POTA_CLOAB Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=potA PE=3 SV=1 114 325 3.0E-09
sp|Q5ZWE4|POTA_LEGPH Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=potA PE=3 SV=2 104 292 3.0E-09
sp|Q57242|UUP1_HAEIN ABC transporter ATP-binding protein uup-1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=uup-A PE=3 SV=1 400 608 4.0E-09
sp|P08720|NODI_RHILV Nod factor export ATP-binding protein I OS=Rhizobium leguminosarum bv. viciae GN=nodI PE=3 SV=1 99 298 4.0E-09
sp|Q88EX5|CCMA_PSEPK Cytochrome c biogenesis ATP-binding export protein CcmA OS=Pseudomonas putida (strain KT2440) GN=ccmA PE=3 SV=1 418 577 4.0E-09
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 403 598 4.0E-09
sp|Q6HPM9|ECFA2_BACHK Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ecfA2 PE=3 SV=1 401 598 4.0E-09
sp|Q81VQ1|ECFA2_BACAN Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Bacillus anthracis GN=ecfA2 PE=3 SV=1 401 598 4.0E-09
sp|Q3SGJ8|PHNC_THIDA Phosphonates import ATP-binding protein PhnC OS=Thiobacillus denitrificans (strain ATCC 25259) GN=phnC PE=3 SV=1 420 607 4.0E-09
sp|Q839D4|ECFA2_ENTFA Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=ecfA2 PE=3 SV=2 99 323 4.0E-09
sp|Q58639|Y1242_METJA Uncharacterized ABC transporter ATP-binding protein MJ1242 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1242 PE=3 SV=1 105 313 4.0E-09
sp|Q5LT05|POTA_RUEPO Spermidine/putrescine import ATP-binding protein PotA OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=potA PE=3 SV=1 118 289 4.0E-09
sp|Q11D92|THIQ_CHESB Thiamine import ATP-binding protein ThiQ OS=Chelativorans sp. (strain BNC1) GN=thiQ PE=3 SV=1 400 608 4.0E-09
sp|Q2KDV1|PHNC_RHIEC Phosphonates import ATP-binding protein PhnC OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=phnC PE=3 SV=1 101 313 4.0E-09
sp|O83658|POTA_TREPA Spermidine/putrescine import ATP-binding protein PotA OS=Treponema pallidum (strain Nichols) GN=potA PE=3 SV=1 100 266 4.0E-09
sp|Q02ME3|METN1_PSEAB Methionine import ATP-binding protein MetN 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=metN1 PE=3 SV=1 110 323 4.0E-09
sp|Q5NFU5|METN_FRATT Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=metN PE=3 SV=2 103 342 4.0E-09
sp|Q7UU57|RBSA_RHOBA Ribose import ATP-binding protein RbsA OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=rbsA PE=3 SV=1 399 622 5.0E-09
sp|Q9L1C3|METN_STRCO Methionine import ATP-binding protein MetN OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=metN PE=3 SV=2 110 310 5.0E-09
sp|A0K5N5|METN1_BURCH Methionine import ATP-binding protein MetN 1 OS=Burkholderia cenocepacia (strain HI2424) GN=metN1 PE=3 SV=2 107 298 5.0E-09
sp|Q1BY14|METN1_BURCA Methionine import ATP-binding protein MetN 1 OS=Burkholderia cenocepacia (strain AU 1054) GN=metN1 PE=3 SV=2 107 298 5.0E-09
sp|Q8RCU0|PSTB1_CALS4 Phosphate import ATP-binding protein PstB 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pstB1 PE=3 SV=1 418 602 5.0E-09
sp|Q57SD6|PHNT_SALCH Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella choleraesuis (strain SC-B67) GN=phnT PE=3 SV=1 77 289 5.0E-09
sp|P32010|DRRA_STRPE Daunorubicin/doxorubicin resistance ATP-binding protein DrrA OS=Streptomyces peucetius GN=drrA PE=1 SV=1 425 617 5.0E-09
sp|Q5PFQ7|PHNT_SALPA Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=phnT PE=3 SV=1 83 289 5.0E-09
sp|O34900|TCYN_BACSU L-cystine import ATP-binding protein TcyN OS=Bacillus subtilis (strain 168) GN=tcyN PE=1 SV=1 115 304 5.0E-09
sp|Q21QL9|CCMA_RHOFT Cytochrome c biogenesis ATP-binding export protein CcmA OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=ccmA PE=3 SV=1 399 591 5.0E-09
sp|Q5JEB0|WTPC_THEKO Molybdate/tungstate import ATP-binding protein WtpC OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=wtpC PE=3 SV=1 99 292 5.0E-09
sp|Q9I1C8|METN1_PSEAE Methionine import ATP-binding protein MetN 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=metN1 PE=3 SV=1 110 323 5.0E-09
sp|Q50294|ECFA1_MYCPN Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ecfA1 PE=3 SV=1 402 599 5.0E-09
sp|Q9CN78|LOLD_PASMU Lipoprotein-releasing system ATP-binding protein LolD OS=Pasteurella multocida (strain Pm70) GN=lolD PE=3 SV=1 104 291 5.0E-09
sp|Q8GNH6|NODI_RHIML Nod factor export ATP-binding protein I OS=Rhizobium meliloti GN=nodI PE=3 SV=1 396 555 5.0E-09
sp|Q39T41|LOLD_GEOMG Lipoprotein-releasing system ATP-binding protein LolD OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=lolD PE=3 SV=1 110 290 5.0E-09
sp|Q8PUE7|Y2387_METMA Putative ABC transporter ATP-binding protein MM_2387 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_2387 PE=3 SV=1 110 304 5.0E-09
sp|Q8TQW9|Y1418_METAC Putative ABC transporter ATP-binding protein MA_1418 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1418 PE=3 SV=1 100 304 5.0E-09
sp|Q1GBJ0|ECFA1_LACDA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=ecfA1 PE=3 SV=1 400 595 6.0E-09
sp|Q6G2E2|METN_BARHE Methionine import ATP-binding protein MetN OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=metN PE=3 SV=1 109 340 6.0E-09
sp|Q4JTG9|METN_CORJK Methionine import ATP-binding protein MetN OS=Corynebacterium jeikeium (strain K411) GN=metN PE=3 SV=1 105 329 6.0E-09
sp|Q9A502|METN_CAUCR Methionine import ATP-binding protein MetN OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=metN PE=3 SV=1 93 298 6.0E-09
sp|Q7CHF8|METN2_YERPE Methionine import ATP-binding protein MetN 2 OS=Yersinia pestis GN=metN2 PE=3 SV=1 103 298 6.0E-09
sp|Q1C970|METN2_YERPA Methionine import ATP-binding protein MetN 2 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=metN2 PE=3 SV=1 103 298 6.0E-09
sp|Q66CQ3|METN1_YERPS Methionine import ATP-binding protein MetN 1 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=metN1 PE=3 SV=1 103 298 6.0E-09
sp|Q1CG91|METN1_YERPN Methionine import ATP-binding protein MetN 1 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=metN1 PE=3 SV=1 103 298 6.0E-09
sp|Q9N0V3|ABCBB_RABIT Bile salt export pump OS=Oryctolagus cuniculus GN=ABCB11 PE=2 SV=1 364 595 6.0E-09
sp|Q2RZ08|HMUV_SALRD Hemin import ATP-binding protein HmuV OS=Salinibacter ruber (strain DSM 13855 / M31) GN=hmuV PE=3 SV=1 432 592 6.0E-09
sp|Q65F80|METN2_BACLD Methionine import ATP-binding protein MetN 2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=metN2 PE=3 SV=1 400 595 6.0E-09
sp|Q7MFC4|MALK_VIBVY Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio vulnificus (strain YJ016) GN=malK PE=3 SV=1 100 289 6.0E-09
sp|Q8D3V0|MALK_VIBVU Maltose/maltodextrin import ATP-binding protein MalK OS=Vibrio vulnificus (strain CMCP6) GN=malK PE=3 SV=1 100 289 6.0E-09
sp|Q7N6R3|MODC_PHOLL Molybdenum import ATP-binding protein ModC OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=modC PE=3 SV=1 417 600 6.0E-09
sp|Q88XV1|ECFA2_LACPL Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=ecfA2 PE=3 SV=1 105 307 6.0E-09
sp|Q93DA2|METN_STRMU Methionine import ATP-binding protein MetN OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=metN PE=3 SV=1 109 346 6.0E-09
sp|C0SPB4|YHAQ_BACSU Uncharacterized ABC transporter ATP-binding protein YhaQ OS=Bacillus subtilis (strain 168) GN=yhaQ PE=3 SV=1 400 621 7.0E-09
sp|Q0I3C2|LOLD_HAES1 Lipoprotein-releasing system ATP-binding protein LolD OS=Haemophilus somnus (strain 129Pt) GN=lolD PE=3 SV=1 111 293 7.0E-09
sp|Q13VD7|METN1_BURXL Methionine import ATP-binding protein MetN 1 OS=Burkholderia xenovorans (strain LB400) GN=metN1 PE=3 SV=1 107 298 7.0E-09
sp|Q18CI9|ECFA2_PEPD6 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Peptoclostridium difficile (strain 630) GN=ecfA2 PE=3 SV=1 107 313 7.0E-09
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 401 598 8.0E-09
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 401 578 8.0E-09
sp|Q6LHL2|MODC_PHOPR Molybdenum import ATP-binding protein ModC OS=Photobacterium profundum GN=modC PE=3 SV=1 107 302 8.0E-09
sp|Q2NTI7|ZNUC_SODGM Zinc import ATP-binding protein ZnuC OS=Sodalis glossinidius (strain morsitans) GN=znuC PE=3 SV=1 434 612 8.0E-09
sp|Q63H61|ECFA2_BACCZ Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Bacillus cereus (strain ZK / E33L) GN=ecfA2 PE=3 SV=1 401 598 8.0E-09
sp|Q9HZL7|LOLD_PSEAE Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lolD PE=3 SV=1 104 293 8.0E-09
sp|Q4KC87|FBPC_PSEF5 Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=fbpC PE=3 SV=1 99 323 8.0E-09
sp|O52618|NODI_RHIME Nod factor export ATP-binding protein I OS=Rhizobium meliloti (strain 1021) GN=nodI PE=3 SV=3 90 298 9.0E-09
sp|Q5WXF0|POTA_LEGPL Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Lens) GN=potA PE=3 SV=1 104 292 9.0E-09
sp|Q73F66|ECFA2_BACC1 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ecfA2 PE=3 SV=1 401 598 9.0E-09
sp|Q48IS7|ARAG_PSE14 Arabinose import ATP-binding protein AraG OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=araG PE=3 SV=1 98 598 9.0E-09
sp|Q92V71|PHNC_RHIME Phosphonates import ATP-binding protein PhnC OS=Rhizobium meliloti (strain 1021) GN=phnC PE=3 SV=1 99 304 9.0E-09
sp|O14134|ELF1_SCHPO mRNA export factor elf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=elf1 PE=1 SV=1 405 591 1.0E-08
sp|Q6D3Q6|METN2_PECAS Methionine import ATP-binding protein MetN 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN2 PE=3 SV=1 405 592 1.0E-08
sp|Q4L884|ECFA2_STAHJ Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ecfA2 PE=3 SV=1 109 304 1.0E-08
sp|Q8GEH7|METN_ERWPE Methionine import ATP-binding protein MetN OS=Erwinia pyrifoliae (strain Ep1/96) GN=metN PE=3 SV=1 105 298 1.0E-08
sp|Q8Y0C6|LOLD_RALSO Lipoprotein-releasing system ATP-binding protein LolD OS=Ralstonia solanacearum (strain GMI1000) GN=lolD PE=3 SV=1 417 609 1.0E-08
sp|Q0HJG0|LOLD_SHESM Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella sp. (strain MR-4) GN=lolD PE=3 SV=2 400 590 1.0E-08
sp|Q6LQC0|HMUV_PHOPR Hemin import ATP-binding protein HmuV OS=Photobacterium profundum GN=hmuV PE=3 SV=1 418 604 1.0E-08
sp|Q0BH79|METN1_BURCM Methionine import ATP-binding protein MetN 1 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metN1 PE=3 SV=1 107 298 1.0E-08
sp|Q4QMH4|METN_HAEI8 Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain 86-028NP) GN=metN PE=3 SV=1 107 310 1.0E-08
sp|Q555Z5|ABCA4_DICDI ABC transporter A family member 4 OS=Dictyostelium discoideum GN=abcA4 PE=3 SV=1 423 600 1.0E-08
sp|Q21JQ9|LOLD_SACD2 Lipoprotein-releasing system ATP-binding protein LolD OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=lolD PE=3 SV=1 109 295 1.0E-08
sp|Q81J15|ECFA2_BACCR Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ecfA2 PE=3 SV=1 401 598 1.0E-08
sp|Q8DMY0|ECFA2_STRR6 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ecfA2 PE=3 SV=1 105 292 1.0E-08
sp|Q04HV8|ECFA2_STRP2 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=ecfA2 PE=3 SV=1 105 292 1.0E-08
sp|P54591|YHCG_BACSU Uncharacterized ABC transporter ATP-binding protein YhcG OS=Bacillus subtilis (strain 168) GN=yhcG PE=3 SV=1 433 595 1.0E-08
sp|Q2K0S7|RBSA3_RHIEC Ribose import ATP-binding protein RbsA 3 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rbsA3 PE=3 SV=1 96 309 1.0E-08
sp|P04285|OPPD_SALTY Oligopeptide transport ATP-binding protein OppD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=oppD PE=3 SV=1 225 362 1.0E-08
sp|P0A2V5|OPPF_LACLS Oligopeptide transport ATP-binding protein OppF OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=oppF PE=3 SV=1 103 303 1.0E-08
sp|P0A2V4|OPPF_LACLA Oligopeptide transport ATP-binding protein OppF OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=oppF PE=3 SV=1 103 303 1.0E-08
sp|Q4KBU0|METN3_PSEF5 Methionine import ATP-binding protein MetN 3 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=metN3 PE=3 SV=1 118 313 1.0E-08
sp|Q8YA75|METN1_LISMO Methionine import ATP-binding protein MetN 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=metN1 PE=3 SV=1 93 323 1.0E-08
sp|Q134N9|METN_RHOPS Methionine import ATP-binding protein MetN OS=Rhodopseudomonas palustris (strain BisB5) GN=metN PE=3 SV=2 103 325 1.0E-08
sp|Q0BZD8|PHNC_HYPNA Phosphonates import ATP-binding protein PhnC OS=Hyphomonas neptunium (strain ATCC 15444) GN=phnC PE=3 SV=1 94 305 1.0E-08
sp|Q04BY7|ECFA1_LACDB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=ecfA1 PE=3 SV=1 400 595 1.0E-08
sp|P96063|PHNT_SALTY Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=phnT PE=2 SV=1 75 289 1.0E-08
sp|Q2JLH7|PHNC2_SYNJB Phosphonates import ATP-binding protein PhnC 2 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=phnC2 PE=3 SV=1 433 591 1.0E-08
sp|Q39B28|HMUV_BURL3 Hemin import ATP-binding protein HmuV OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=hmuV PE=3 SV=1 418 598 1.0E-08
sp|P26050|NODI_BRADU Nod factor export ATP-binding protein I OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodI PE=3 SV=2 84 345 1.0E-08
sp|Q71X09|METN2_LISMF Methionine import ATP-binding protein MetN 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=metN2 PE=3 SV=1 400 595 1.0E-08
sp|Q9WXX8|Y124_THEMA Probable metal transport system ATP-binding protein TM_0124 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0124 PE=3 SV=1 417 600 1.0E-08
sp|P0A2U7|ADCC_STRR6 Zinc transport system ATP-binding protein AdcC OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=adcC PE=3 SV=1 401 579 1.0E-08
sp|P0A2U6|ADCC_STRPN Zinc transport system ATP-binding protein AdcC OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=adcC PE=3 SV=1 401 579 1.0E-08
sp|Q9Z8Q8|METN_CHLPN Methionine import ATP-binding protein MetN OS=Chlamydia pneumoniae GN=metN PE=3 SV=1 102 331 1.0E-08
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 401 599 1.0E-08
sp|Q14H97|METN_FRAT1 Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=metN PE=3 SV=2 103 342 1.0E-08
sp|Q8ELA5|METN4_OCEIH Methionine import ATP-binding protein MetN 4 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=metN4 PE=3 SV=1 105 298 1.0E-08
sp|Q39IE7|METN1_BURL3 Methionine import ATP-binding protein MetN 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=metN1 PE=3 SV=1 110 298 1.0E-08
sp|Q74AT2|LOLD_GEOSL Lipoprotein-releasing system ATP-binding protein LolD OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=lolD PE=3 SV=1 405 605 1.0E-08
sp|Q1LPJ9|LOLD_CUPMC Lipoprotein-releasing system ATP-binding protein LolD OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=lolD PE=3 SV=1 115 305 1.0E-08
sp|P9WQK3|ETTA_MYCTU Energy-dependent translational throttle protein EttA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ettA PE=1 SV=1 421 615 2.0E-08
sp|P9WQK2|ETTA_MYCTO Energy-dependent translational throttle protein EttA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ettA PE=3 SV=1 421 615 2.0E-08
sp|Q3A9G5|METN_CARHZ Methionine import ATP-binding protein MetN OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=metN PE=3 SV=1 400 595 2.0E-08
sp|Q97JB8|Y1368_CLOAB Putative ABC transporter ATP-binding protein CA_C1368 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1368 PE=3 SV=1 401 592 2.0E-08
sp|Q58283|Y873_METJA Uncharacterized ABC transporter ATP-binding protein MJ0873 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0873 PE=3 SV=4 94 359 2.0E-08
sp|P61482|LOLD_SALTY Lipoprotein-releasing system ATP-binding protein LolD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=lolD PE=3 SV=1 104 293 2.0E-08
sp|P61481|LOLD_SALTI Lipoprotein-releasing system ATP-binding protein LolD OS=Salmonella typhi GN=lolD PE=3 SV=1 104 293 2.0E-08
sp|Q5PGR6|LOLD_SALPA Lipoprotein-releasing system ATP-binding protein LolD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=lolD PE=3 SV=1 104 293 2.0E-08
sp|Q62B84|METN2_BURMA Methionine import ATP-binding protein MetN 2 OS=Burkholderia mallei (strain ATCC 23344) GN=metN2 PE=3 SV=2 105 351 2.0E-08
sp|P76027|OPPD_ECOLI Oligopeptide transport ATP-binding protein OppD OS=Escherichia coli (strain K12) GN=oppD PE=3 SV=2 105 321 2.0E-08
sp|P44785|METN_HAEIN Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metN PE=3 SV=1 107 310 2.0E-08
sp|Q39GT7|NODI_BURL3 Nod factor export ATP-binding protein I OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nodI PE=3 SV=2 433 555 2.0E-08
sp|Q1MEG2|ZNUC_RHIL3 Zinc import ATP-binding protein ZnuC OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=znuC PE=3 SV=1 399 613 2.0E-08
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 401 621 2.0E-08
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 401 598 2.0E-08
sp|Q3JHC9|METN2_BURP1 Methionine import ATP-binding protein MetN 2 OS=Burkholderia pseudomallei (strain 1710b) GN=metN2 PE=3 SV=2 105 301 2.0E-08
sp|Q724C0|METN1_LISMF Methionine import ATP-binding protein MetN 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=metN1 PE=3 SV=1 93 323 2.0E-08
sp|Q6D5H7|METN1_PECAS Methionine import ATP-binding protein MetN 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN1 PE=3 SV=1 421 598 3.0E-08
sp|Q08972|NEW1_YEAST [NU+] prion formation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEW1 PE=1 SV=1 431 608 4.0E-08
sp|Q832Y6|METN1_ENTFA Methionine import ATP-binding protein MetN 1 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=metN1 PE=3 SV=1 105 304 4.0E-08
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 112 303 4.0E-08
sp|Q08972|NEW1_YEAST [NU+] prion formation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEW1 PE=1 SV=1 521 595 5.0E-08
sp|P50332|NODI_RHIGA Nod factor export ATP-binding protein I OS=Rhizobium galegae GN=nodI PE=3 SV=1 399 557 6.0E-08
sp|Q14Q07|POTA_SPICI Spermidine/putrescine import ATP-binding protein PotA OS=Spiroplasma citri GN=potA PE=3 SV=1 400 599 6.0E-08
sp|Q81J15|ECFA2_BACCR Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ecfA2 PE=3 SV=1 102 292 6.0E-08
sp|Q0I5E9|METN_HAES1 Methionine import ATP-binding protein MetN OS=Haemophilus somnus (strain 129Pt) GN=metN PE=3 SV=1 407 607 7.0E-08
sp|Q8GNH6|NODI_RHIML Nod factor export ATP-binding protein I OS=Rhizobium meliloti GN=nodI PE=3 SV=1 109 309 7.0E-08
sp|Q5L222|POTA_GEOKA Spermidine/putrescine import ATP-binding protein PotA OS=Geobacillus kaustophilus (strain HTA426) GN=potA PE=3 SV=1 400 556 9.0E-08
sp|O14134|ELF1_SCHPO mRNA export factor elf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=elf1 PE=1 SV=1 504 589 1.0E-07
sp|Q8Z8R5|METN2_SALTI Methionine import ATP-binding protein MetN 2 OS=Salmonella typhi GN=metN2 PE=3 SV=1 434 592 1.0E-07
sp|Q5PCG9|METN2_SALPA Methionine import ATP-binding protein MetN 2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metN2 PE=3 SV=1 421 592 1.0E-07
sp|Q7NTU0|LOLD_CHRVO Lipoprotein-releasing system ATP-binding protein LolD OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=lolD PE=3 SV=1 400 596 1.0E-07
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 110 326 1.0E-07
sp|Q8RCU0|PSTB1_CALS4 Phosphate import ATP-binding protein PstB 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pstB1 PE=3 SV=1 118 292 1.0E-07
sp|Q74AT2|LOLD_GEOSL Lipoprotein-releasing system ATP-binding protein LolD OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=lolD PE=3 SV=1 110 290 1.0E-07
sp|O31716|YKPA_BACSU Uncharacterized ABC transporter ATP-binding protein YkpA OS=Bacillus subtilis (strain 168) GN=ykpA PE=3 SV=1 223 304 2.0E-07
sp|P46903|NATA_BACSU ABC transporter ATP-binding protein NatA OS=Bacillus subtilis (strain 168) GN=natA PE=1 SV=1 420 567 2.0E-07
sp|Q57S53|METN2_SALCH Methionine import ATP-binding protein MetN 2 OS=Salmonella choleraesuis (strain SC-B67) GN=metN2 PE=3 SV=1 434 592 2.0E-07
sp|Q8ZR89|METN2_SALTY Methionine import ATP-binding protein MetN 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metN2 PE=3 SV=1 434 592 2.0E-07
sp|Q9XDA6|ZURA_LISMO Zinc uptake system ATP-binding protein ZurA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=zurA PE=3 SV=1 110 339 2.0E-07
sp|Q8RI39|POTA_FUSNN Spermidine/putrescine import ATP-binding protein PotA OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=potA PE=3 SV=1 418 555 2.0E-07
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 401 598 2.0E-07
sp|Q51719|YCOBA_PROFR Putative ABC transporter ATP-binding protein in cobA 5'region OS=Propionibacterium freudenreichii subsp. shermanii PE=3 SV=1 109 291 2.0E-07
sp|A3DJK5|ECFA2_CLOTH Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=ecfA2 PE=3 SV=1 110 327 2.0E-07
sp|P26050|NODI_BRADU Nod factor export ATP-binding protein I OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodI PE=3 SV=2 433 555 2.0E-07
sp|Q04FM1|ECFA2_OENOB Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=ecfA2 PE=3 SV=1 421 555 3.0E-07
sp|Q9CN78|LOLD_PASMU Lipoprotein-releasing system ATP-binding protein LolD OS=Pasteurella multocida (strain Pm70) GN=lolD PE=3 SV=1 423 599 3.0E-07
sp|Q88XV1|ECFA2_LACPL Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=ecfA2 PE=3 SV=1 401 598 3.0E-07
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 401 575 3.0E-07
sp|O93796|EF3_CANGA Elongation factor 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TEF3 PE=3 SV=2 524 590 4.0E-07
sp|Q8DFC3|METN_VIBVU Methionine import ATP-binding protein MetN OS=Vibrio vulnificus (strain CMCP6) GN=metN PE=3 SV=1 410 607 4.0E-07
sp|Q7MN25|METN_VIBVY Methionine import ATP-binding protein MetN OS=Vibrio vulnificus (strain YJ016) GN=metN PE=3 SV=1 410 607 4.0E-07
sp|Q8FRX8|METN_COREF Methionine import ATP-binding protein MetN OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=metN PE=3 SV=1 434 594 4.0E-07
sp|Q5PFQ7|PHNT_SALPA Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=phnT PE=3 SV=1 401 586 4.0E-07
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 401 575 4.0E-07
sp|Q926D8|ZURA_LISIN Zinc uptake system ATP-binding protein ZurA OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=zurA PE=3 SV=1 228 339 5.0E-07
sp|Q9S4Z0|METN_SALEN Methionine import ATP-binding protein MetN OS=Salmonella enteritidis GN=metN PE=3 SV=1 432 592 5.0E-07
sp|Q8Z8W8|PHNT_SALTI Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella typhi GN=phnT PE=3 SV=1 401 586 5.0E-07
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 406 598 5.0E-07
sp|Q73F66|ECFA2_BACC1 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ecfA2 PE=3 SV=1 102 292 5.0E-07
sp|O14134|ELF1_SCHPO mRNA export factor elf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=elf1 PE=1 SV=1 235 298 6.0E-07
sp|Q080S4|LOLD_SHEFN Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella frigidimarina (strain NCIMB 400) GN=lolD PE=3 SV=1 115 289 6.0E-07
sp|Q48PU6|METN1_PSE14 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=metN1 PE=3 SV=1 400 598 7.0E-07
sp|Q4ZZR8|METN1_PSEU2 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=metN1 PE=3 SV=1 400 598 7.0E-07
sp|Q32AQ1|NIKE_SHIDS Nickel import ATP-binding protein NikE OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=nikE PE=3 SV=1 410 598 7.0E-07
sp|Q4KKK8|METN1_PSEF5 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=metN1 PE=3 SV=1 434 598 8.0E-07
sp|Q0HJG0|LOLD_SHESM Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella sp. (strain MR-4) GN=lolD PE=3 SV=2 104 289 8.0E-07
sp|Q75EV6|EF3_ASHGO Elongation factor 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TEF3 PE=3 SV=2 524 590 9.0E-07
sp|P25997|EF3_CANAL Elongation factor 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CEF3 PE=1 SV=2 524 590 9.0E-07
sp|P53978|EF3B_YEAST Elongation factor 3B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEF3 PE=1 SV=2 524 590 9.0E-07
sp|Q31VE6|NIKE_SHIBS Nickel import ATP-binding protein NikE OS=Shigella boydii serotype 4 (strain Sb227) GN=nikE PE=3 SV=1 410 598 9.0E-07
sp|P29551|EF3_PNECA Elongation factor 3 OS=Pneumocystis carinii GN=TEF3 PE=3 SV=1 510 595 1.0E-06
sp|P45167|UUP2_HAEIN ABC transporter ATP-binding protein uup-2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=uup-B PE=3 SV=1 78 321 1.0E-06
sp|Q87UN4|METN2_PSESM Methionine import ATP-binding protein MetN 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=metN2 PE=3 SV=1 400 598 1.0E-06
sp|Q8X4L6|NIKE_ECO57 Nickel import ATP-binding protein NikE OS=Escherichia coli O157:H7 GN=nikE PE=3 SV=1 410 598 1.0E-06
sp|Q7UX73|LOLD1_RHOBA Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=lolD1 PE=3 SV=1 407 599 1.0E-06
sp|Q6HPM9|ECFA2_BACHK Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ecfA2 PE=3 SV=1 102 292 1.0E-06
sp|Q81VQ1|ECFA2_BACAN Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Bacillus anthracis GN=ecfA2 PE=3 SV=1 102 292 1.0E-06
sp|Q8DMY0|ECFA2_STRR6 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ecfA2 PE=3 SV=1 401 594 1.0E-06
sp|Q04HV8|ECFA2_STRP2 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=ecfA2 PE=3 SV=1 401 594 1.0E-06
sp|Q2JLH7|PHNC2_SYNJB Phosphonates import ATP-binding protein PhnC 2 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=phnC2 PE=3 SV=1 109 266 1.0E-06
sp|Q57242|UUP1_HAEIN ABC transporter ATP-binding protein uup-1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=uup-A PE=3 SV=1 74 318 2.0E-06
sp|P29551|EF3_PNECA Elongation factor 3 OS=Pneumocystis carinii GN=TEF3 PE=3 SV=1 231 316 2.0E-06
sp|Q88RL5|METN1_PSEPK Methionine import ATP-binding protein MetN 1 OS=Pseudomonas putida (strain KT2440) GN=metN1 PE=3 SV=1 434 607 2.0E-06
sp|P33594|NIKE_ECOLI Nickel import ATP-binding protein NikE OS=Escherichia coli (strain K12) GN=nikE PE=3 SV=2 410 598 2.0E-06
sp|Q3J1N0|METN_RHOS4 Methionine import ATP-binding protein MetN OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=metN PE=3 SV=1 401 598 2.0E-06
sp|Q87RS1|METN_VIBPA Methionine import ATP-binding protein MetN OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=metN PE=1 SV=1 410 607 2.0E-06
sp|Q8NSN2|METN_CORGL Methionine import ATP-binding protein MetN OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metN PE=3 SV=1 401 595 2.0E-06
sp|Q12NL5|LOLD_SHEDO Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=lolD PE=3 SV=1 86 293 2.0E-06
sp|Q57SD6|PHNT_SALCH Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella choleraesuis (strain SC-B67) GN=phnT PE=3 SV=1 401 555 2.0E-06
sp|Q6G2E2|METN_BARHE Methionine import ATP-binding protein MetN OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=metN PE=3 SV=1 398 592 2.0E-06
sp|Q0BZD8|PHNC_HYPNA Phosphonates import ATP-binding protein PhnC OS=Hyphomonas neptunium (strain ATCC 15444) GN=phnC PE=3 SV=1 399 617 2.0E-06
sp|P96063|PHNT_SALTY Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=phnT PE=2 SV=1 401 586 2.0E-06
sp|Q3YW48|NIKE_SHISS Nickel import ATP-binding protein NikE OS=Shigella sonnei (strain Ss046) GN=nikE PE=3 SV=1 410 598 3.0E-06
sp|Q3M5J9|SSUB_ANAVT Aliphatic sulfonates import ATP-binding protein SsuB OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=ssuB PE=3 SV=1 433 598 4.0E-06
sp|P0C0E2|SRTF_STRPY Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes GN=srtF PE=3 SV=1 102 289 5.0E-06
sp|P0C0E3|SRTF_STRP1 Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes serotype M1 GN=srtF PE=3 SV=1 102 289 5.0E-06
sp|Q55740|Y385_SYNY3 Putative ABC transporter ATP-binding protein sll0385 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0385 PE=3 SV=1 398 598 5.0E-06
sp|Q63H61|ECFA2_BACCZ Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Bacillus cereus (strain ZK / E33L) GN=ecfA2 PE=3 SV=1 102 292 5.0E-06
sp|Q3KK97|METN1_PSEPF Methionine import ATP-binding protein MetN 1 OS=Pseudomonas fluorescens (strain Pf0-1) GN=metN1 PE=3 SV=1 434 598 6.0E-06
sp|P45022|Y1078_HAEIN Probable amino-acid ABC transporter ATP-binding protein HI_1078 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1078 PE=3 SV=1 400 592 6.0E-06
sp|Q92LX3|METN_RHIME Methionine import ATP-binding protein MetN OS=Rhizobium meliloti (strain 1021) GN=metN PE=3 SV=1 421 598 6.0E-06
sp|Q03A07|METN_LACC3 Methionine import ATP-binding protein MetN OS=Lactobacillus casei (strain ATCC 334) GN=metN PE=3 SV=1 400 613 6.0E-06
sp|O94489|EF3_SCHPO Elongation factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef3 PE=1 SV=1 221 318 7.0E-06
sp|Q6FAN3|METN1_ACIAD Methionine import ATP-binding protein MetN 1 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metN1 PE=3 SV=1 407 598 7.0E-06
sp|Q0SZJ3|NIKE_SHIF8 Nickel import ATP-binding protein NikE OS=Shigella flexneri serotype 5b (strain 8401) GN=nikE PE=3 SV=1 410 598 8.0E-06
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 401 555 8.0E-06
sp|P16521|EF3A_YEAST Elongation factor 3A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEF3 PE=1 SV=4 524 590 9.0E-06
sp|P25256|TLRC_STRFR Tylosin resistance ATP-binding protein TlrC OS=Streptomyces fradiae GN=tlrC PE=3 SV=1 110 305 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5468
MPSASKEKRLAKKAAEGKLDKKGNKVSSKSKKEETQLDANGKPIQNDDAPATSGDKLNEVKRLADQMDKHGISDR
VTTGVLASTQSSKDVKIISTSLVFHGRVLITDSTLELSFGRRYGLLGENGCGKSTLLKAIAAREYPIPDHIDIYL
LNEGAPPSDLGALDWVVREAELELERLDKLAEKMLEEEGPESPVLADLYDHMDKMDPSTFSTRASLILTGLGFNK
KTIQKKTKDMSGGWRMRVALAKALFVKPSLLLLDDPTAHLDLEACVWLEEYLKKWERTLVLVSHSMDFLNGVCTS
MIDMRGRQLQYYGGNYDSYHKTRSENETNQMKAYTKQQDEIAHIKKFIASAGTYANLVKQAKSRQKILDKMEADG
FIQPVTPDKVFTFRFADVEKLPPPVLSFDDVTFSYSGKPEDDLYRNLDLGFDMDSRTALVGPNGVGKSTLLRLMT
GKLSPTGGVVTRHTHLKLGLYSQHSAEQLDLTKSALDFVRDKYADKSQDYQYWRQQLGRYGLSGDSQTALMGTLS
EGQKSRIVFALLAIDGPNMLLLDEPTNGLDIPTIDSLADAINAFNGGVVVVSHDFRLLDKIAKQILVCENKTIRT
WDGTIGEYKDYLRKKMISAGSV*
Coding >OphauG2|5468
ATGCCGTCGGCCTCCAAAGAAAAGAGACTCGCCAAAAAGGCGGCAGAGGGCAAACTCGACAAAAAGGGCAACAAG
GTGTCGTCCAAGTCGAAAAAGGAAGAGACACAGCTCGATGCCAATGGAAAGCCCATTCAGAATGATGATGCCCCT
GCCACGTCGGGCGACAAGCTCAACGAGGTCAAGCGCCTGGCCGACCAGATGGACAAGCACGGCATCTCGGATCGA
GTCACCACCGGTGTCCTTGCCTCTACCCAATCCAGCAAAGATGTAAAGATTATCAGTACCAGTCTCGTTTTCCAC
GGCCGTGTTCTCATTACCGATTCGACTCTCGAGTTGTCCTTTGGCCGTCGCTACGGCTTGCTCGGAGAGAACGGC
TGTGGCAAAAGCACCCTGCTCAAGGCCATTGCTGCCCGCGAGTATCCCATTCCTGATCACATCGATATCTACCTG
CTCAACGAGGGTGCCCCTCCTTCAGACCTCGGTGCTCTGGATTGGGTCGTCAGAGAAGCCGAGCTGGAACTTGAG
CGCCTCGACAAGCTTGCCGAAAAGATGCTCGAGGAGGAAGGGCCCGAAAGCCCGGTCCTAGCTGATCTCTATGAT
CACATGGACAAGATGGACCCCTCCACCTTTTCCACCCGCGCCTCCCTCATCCTCACTGGTCTCGGTTTCAACAAG
AAGACGATTCAGAAAAAGACAAAGGACATGTCTGGTGGCTGGCGTATGCGAGTTGCTCTTGCCAAAGCTCTCTTC
GTCAAGCCCTCTTTGCTTCTGCTCGACGACCCCACAGCTCACTTGGATCTCGAGGCTTGCGTGTGGCTTGAGGAA
TATCTCAAGAAATGGGAGCGCACGCTTGTGCTCGTCTCTCACTCCATGGACTTTCTCAACGGTGTCTGCACCAGC
ATGATTGACATGCGTGGCCGTCAGCTGCAGTACTACGGTGGAAACTACGACTCGTATCACAAGACGCGGTCTGAA
AACGAAACGAATCAAATGAAGGCGTATACTAAGCAGCAAGATGAAATTGCGCACATCAAAAAGTTTATTGCCAGC
GCCGGTACTTATGCTAATCTTGTCAAGCAAGCCAAGTCACGGCAGAAGATTCTGGACAAGATGGAGGCGGATGGC
TTCATTCAGCCCGTGACGCCCGACAAGGTTTTTACTTTTCGCTTTGCCGACGTGGAGAAGCTGCCGCCTCCTGTC
CTTTCGTTTGACGACGTTACATTTTCATACTCTGGAAAGCCCGAGGATGACCTGTACCGTAACCTGGACCTTGGA
TTCGACATGGATTCGCGTACTGCCCTCGTCGGCCCCAATGGTGTGGGCAAGTCGACTCTACTGCGCCTCATGACG
GGCAAGCTGTCGCCCACTGGCGGTGTTGTTACCCGCCATACTCACCTCAAGCTTGGCCTCTACTCACAGCACAGT
GCCGAGCAATTGGACCTGACCAAGTCGGCTCTCGACTTTGTGCGAGACAAGTACGCAGACAAATCACAAGACTAC
CAATACTGGCGCCAGCAGCTTGGCCGCTACGGTCTCTCTGGCGATTCCCAAACTGCCCTCATGGGCACTTTGTCG
GAAGGGCAAAAAAGCCGCATCGTGTTTGCACTGCTCGCCATTGACGGCCCCAACATGCTCTTGCTTGACGAGCCG
ACAAACGGTCTCGACATTCCCACAATCGACAGTTTGGCCGATGCCATCAATGCCTTTAACGGAGGTGTCGTTGTT
GTGTCTCACGACTTTAGGTTACTCGACAAGATTGCAAAGCAGATTTTGGTGTGTGAGAACAAGACGATTCGCACA
TGGGACGGCACCATAGGCGAATACAAGGACTACCTGCGCAAAAAGATGATTTCGGCTGGCTCGGTTTAA
Transcript >OphauG2|5468
ATGCCGTCGGCCTCCAAAGAAAAGAGACTCGCCAAAAAGGCGGCAGAGGGCAAACTCGACAAAAAGGGCAACAAG
GTGTCGTCCAAGTCGAAAAAGGAAGAGACACAGCTCGATGCCAATGGAAAGCCCATTCAGAATGATGATGCCCCT
GCCACGTCGGGCGACAAGCTCAACGAGGTCAAGCGCCTGGCCGACCAGATGGACAAGCACGGCATCTCGGATCGA
GTCACCACCGGTGTCCTTGCCTCTACCCAATCCAGCAAAGATGTAAAGATTATCAGTACCAGTCTCGTTTTCCAC
GGCCGTGTTCTCATTACCGATTCGACTCTCGAGTTGTCCTTTGGCCGTCGCTACGGCTTGCTCGGAGAGAACGGC
TGTGGCAAAAGCACCCTGCTCAAGGCCATTGCTGCCCGCGAGTATCCCATTCCTGATCACATCGATATCTACCTG
CTCAACGAGGGTGCCCCTCCTTCAGACCTCGGTGCTCTGGATTGGGTCGTCAGAGAAGCCGAGCTGGAACTTGAG
CGCCTCGACAAGCTTGCCGAAAAGATGCTCGAGGAGGAAGGGCCCGAAAGCCCGGTCCTAGCTGATCTCTATGAT
CACATGGACAAGATGGACCCCTCCACCTTTTCCACCCGCGCCTCCCTCATCCTCACTGGTCTCGGTTTCAACAAG
AAGACGATTCAGAAAAAGACAAAGGACATGTCTGGTGGCTGGCGTATGCGAGTTGCTCTTGCCAAAGCTCTCTTC
GTCAAGCCCTCTTTGCTTCTGCTCGACGACCCCACAGCTCACTTGGATCTCGAGGCTTGCGTGTGGCTTGAGGAA
TATCTCAAGAAATGGGAGCGCACGCTTGTGCTCGTCTCTCACTCCATGGACTTTCTCAACGGTGTCTGCACCAGC
ATGATTGACATGCGTGGCCGTCAGCTGCAGTACTACGGTGGAAACTACGACTCGTATCACAAGACGCGGTCTGAA
AACGAAACGAATCAAATGAAGGCGTATACTAAGCAGCAAGATGAAATTGCGCACATCAAAAAGTTTATTGCCAGC
GCCGGTACTTATGCTAATCTTGTCAAGCAAGCCAAGTCACGGCAGAAGATTCTGGACAAGATGGAGGCGGATGGC
TTCATTCAGCCCGTGACGCCCGACAAGGTTTTTACTTTTCGCTTTGCCGACGTGGAGAAGCTGCCGCCTCCTGTC
CTTTCGTTTGACGACGTTACATTTTCATACTCTGGAAAGCCCGAGGATGACCTGTACCGTAACCTGGACCTTGGA
TTCGACATGGATTCGCGTACTGCCCTCGTCGGCCCCAATGGTGTGGGCAAGTCGACTCTACTGCGCCTCATGACG
GGCAAGCTGTCGCCCACTGGCGGTGTTGTTACCCGCCATACTCACCTCAAGCTTGGCCTCTACTCACAGCACAGT
GCCGAGCAATTGGACCTGACCAAGTCGGCTCTCGACTTTGTGCGAGACAAGTACGCAGACAAATCACAAGACTAC
CAATACTGGCGCCAGCAGCTTGGCCGCTACGGTCTCTCTGGCGATTCCCAAACTGCCCTCATGGGCACTTTGTCG
GAAGGGCAAAAAAGCCGCATCGTGTTTGCACTGCTCGCCATTGACGGCCCCAACATGCTCTTGCTTGACGAGCCG
ACAAACGGTCTCGACATTCCCACAATCGACAGTTTGGCCGATGCCATCAATGCCTTTAACGGAGGTGTCGTTGTT
GTGTCTCACGACTTTAGGTTACTCGACAAGATTGCAAAGCAGATTTTGGTGTGTGAGAACAAGACGATTCGCACA
TGGGACGGCACCATAGGCGAATACAAGGACTACCTGCGCAAAAAGATGATTTCGGCTGGCTCGGTTTAA
Gene >OphauG2|5468
ATGCCGTCGGCCTCCAAAGAAAAGAGACTCGCCAAAAAGGCGGCAGAGGGCAAACTCGACAAAAAGGGCAACAAG
GTGTCGTCCAAGTCGAAAAAGGAAGAGACACAGCTCGATGCCAATGGAAAGCCCATTCAGAATGATGATGCCCCT
GCCACGTCGGGCGACAAGCTCAACGAGGTCAAGCGCCTGGCCGACCAGATGGACAAGCACGGCATCTCGGATCGA
GTCACCACCGGTGTCCTTGCCTCTACCCAATCCAGCAAAGATGTAAAGATTATCAGTACCAGTCTCGTTTTCCAC
GGCCGTGTTCTCATTACCGATTCGACTCTCGAGTTGTCCTTTGGCCGTCGCTACGGCTTGCTCGGAGAGAACGGC
TGTGGCAAAAGCACCCTGCTCAAGGCCATTGCTGCCCGCGAGTATCCCATTCCTGATCACATCGATATCTACCTG
CTCAACGAGGGTGCCCCTCCTTCAGACCTCGGTGCTCTGGATTGGGTCGTCAGAGAAGCCGAGCTGGAACTTGAG
CGCCTCGACAAGCTTGCCGAAAAGATGCTCGAGGAGGAAGGGCCCGAAAGCCCGGTCCTAGCTGATCTCTATGAT
GTACGTGTGACCAAGCTCCAAAGACATTGATTTTGCTTTTTCCTGATAAGCTGCTAGCACATGGACAAGATGGAC
CCCTCCACCTTTTCCACCCGCGCCTCCCTCATCCTCACTGGTCTCGGTTTCAACAAGAAGACGATTCAGAAAAAG
ACAAAGGACATGTCTGGTGGCTGGCGTATGCGAGTTGCTCTTGCCAAAGCTCTCTTCGTCAAGCCCTCTTTGCTT
CTGCTCGACGACCCCACAGCTCACTTGGATCTCGAGGCTTGCGTGTGGCTTGAGGAATATCTCAAGAAATGGGAG
CGCACGCTTGTGCTCGTCTCTCACTCCATGGACTTTCTCAACGGTGTCTGCACCAGCATGATTGACATGCGTGGC
CGTCAGCTGCAGTACTACGGTGGAAACTACGACTCGTATCACAAGACGCGGTCTGAAAACGAAACGAATCAAATG
AAGGCGTATACTAAGCAGCAAGATGAAATTGCGCACATCAAAAAGTTTATTGCCAGCGCCGGTACTTATGCTAAT
CTTGTCAAGCAAGCCAAGTCACGGCAGAAGATTCTGGACAAGATGGAGGCGGATGGCTTCATTCAGCCCGTGACG
CCCGACAAGGTTTTTACTTTTCGCTTTGCCGACGTGGAGAAGCTGCCGCCTCCTGTCCTTTCGTTTGACGACGTT
ACATTTTCATACTCTGGAAAGCCCGAGGATGACCTGTACCGTAACCTGGACCTTGGATTCGACATGGATTCGCGT
ACTGCCCTCGTCGGCCCCAATGGTGTGGGCAAGTCGACTCTACTGCGCCTCATGACGGGCAAGCTGTCGCCCACT
GGCGGTGTTGTTACCCGCCATACTCACCTCAAGCTTGGCCTCTACTCACAGCACAGTGCCGAGCAATTGGACCTG
ACCAAGTCGGCTCTCGACTTTGTGCGAGACAAGTACGCAGACAAATCACAAGACTACCAATACTGGCGCCAGCAG
CTTGGCCGCTACGGTCTCTCTGGCGATTCCCAAACTGCCCTCATGGGCACTTTGTCGGAAGGGCAAAAAAGCCGC
ATCGTGTTTGCACTGCTCGCCATTGACGGCCCCAACATGCTCTTGCTTGACGAGCCGACAAACGGTCTCGACATT
CCCACAATCGACAGTTTGGCCGATGCCATCAATGCCTTTAACGGAGGTGTCGTTGTTGTGTCTCACGACTTTAGG
TAAGCATTGTCGCTGCACGTCAGGGTGCAACGCTGACTCTTGCTGACATATGACGATAGGTTACTCGACAAGATT
GCAAAGCAGATTTTGGTGTGTGAGAACAAGACGATTCGCACATGGGACGGCACCATAGGCGAATACAAGGACTAC
CTGCGCAAAAAGATGATTTCGGCTGGCTCGGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail