Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|546
Gene name
LocationContig_113:229..1913
Strand+
Gene length (bp)1684
Transcript length (bp)1182
Coding sequence length (bp)1182
Protein length (aa) 394

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09229 Aha1_N Activator of Hsp90 ATPase, N-terminal 3.4E-42 83 214
PF08327 AHSA1 Activator of Hsp90 ATPase homolog 1-like protein 5.0E-18 269 387

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P782|YNY8_SCHPO Uncharacterized protein C1711.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1711.08 PE=2 SV=1 75 393 4.0E-95
sp|Q12449|AHA1_YEAST Hsp90 co-chaperone AHA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AHA1 PE=1 SV=1 71 393 2.0E-77
sp|O95433|AHSA1_HUMAN Activator of 90 kDa heat shock protein ATPase homolog 1 OS=Homo sapiens GN=AHSA1 PE=1 SV=1 75 393 4.0E-42
sp|Q8BK64|AHSA1_MOUSE Activator of 90 kDa heat shock protein ATPase homolog 1 OS=Mus musculus GN=Ahsa1 PE=1 SV=2 75 393 1.0E-41
sp|Q8N9S3|AHSA2_MOUSE Activator of 90 kDa heat shock protein ATPase homolog 2 OS=Mus musculus GN=Ahsa2 PE=1 SV=2 75 384 5.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P782|YNY8_SCHPO Uncharacterized protein C1711.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1711.08 PE=2 SV=1 75 393 4.0E-95
sp|Q12449|AHA1_YEAST Hsp90 co-chaperone AHA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AHA1 PE=1 SV=1 71 393 2.0E-77
sp|O95433|AHSA1_HUMAN Activator of 90 kDa heat shock protein ATPase homolog 1 OS=Homo sapiens GN=AHSA1 PE=1 SV=1 75 393 4.0E-42
sp|Q8BK64|AHSA1_MOUSE Activator of 90 kDa heat shock protein ATPase homolog 1 OS=Mus musculus GN=Ahsa1 PE=1 SV=2 75 393 1.0E-41
sp|Q8N9S3|AHSA2_MOUSE Activator of 90 kDa heat shock protein ATPase homolog 2 OS=Mus musculus GN=Ahsa2 PE=1 SV=2 75 384 5.0E-34
sp|P53834|HCH1_YEAST Hsp90 co-chaperone HCH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HCH1 PE=1 SV=1 71 219 3.0E-20
sp|Q55DB6|AHSA_DICDI Activator of 90 kDa heat shock protein ATPase homolog OS=Dictyostelium discoideum GN=ahsa PE=2 SV=1 74 391 1.0E-17
sp|A6QQC0|AHSA2_BOVIN Activator of 90 kDa heat shock protein ATPase homolog 2 OS=Bos taurus GN=AHSA2 PE=2 SV=1 75 307 1.0E-15
sp|Q719I0|AHSA2_HUMAN Activator of 90 kDa heat shock protein ATPase homolog 2 OS=Homo sapiens GN=AHSA2 PE=1 SV=2 75 345 8.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0001671 ATPase activator activity Yes
GO:0051087 chaperone binding Yes
GO:0003674 molecular_function No
GO:0005515 protein binding No
GO:0140677 molecular function activator activity No
GO:0005488 binding No
GO:0098772 molecular function regulator activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|546
MLLLLLLLPALVTSAPSSLQLPARHISSTPSDLTAECYLPVATAFQYLTASQSTSLVSPPLRPAQSTSVVMVLHN
PNNWHWVNKDVSQWARKWFEDSLANIEAEDGPVTAKISSVQSMDGDVDVSQRKGKVITIFDVKLVLDYTGSAPDA
ADVSGTITIPEVAHDTEEDEYVFDVDIIAETKEKAPVKALVRSKILPQLRQTFQKLAPALIAEHGKDIQHADGEN
PSSGFSTPKLHTGTTTPRPIAQSSSTTSAIVNTVTVTDNEEFRTTAEEMYQTFVDPARIAAFTRSPPQVFEGAKA
GGKFKLFGGNVSGEYIELEAPNKIIQSWRLSQWPAGHHSTLKIEFDQNDIDHVTVMRVTWDGVPTGQEEVTKRNW
LEYYVKSIKQTFGFGAIL*
Coding >OphauG2|546
ATGCTGCTGCTGCTGCTGCTTTTGCCTGCTCTCGTCACCTCAGCACCCTCCAGCCTCCAGCTTCCAGCCCGCCAC
ATTTCGTCCACCCCATCCGACCTCACCGCAGAGTGCTATTTGCCTGTCGCAACAGCTTTCCAATATCTAACTGCA
AGTCAATCAACCTCACTGGTCTCTCCCCCACTGCGCCCTGCTCAATCTACAAGCGTCGTCATGGTGCTGCACAAC
CCCAATAACTGGCACTGGGTCAACAAGGATGTGTCGCAATGGGCCAGAAAATGGTTCGAGGACAGTCTGGCAAAC
ATAGAGGCCGAGGATGGTCCTGTTACGGCCAAGATTAGCAGCGTCCAGAGCATGGACGGTGATGTCGATGTCAGC
CAGCGCAAGGGCAAAGTCATCACCATTTTTGATGTCAAGCTAGTTCTCGATTATACCGGCTCAGCTCCCGATGCT
GCGGATGTCTCTGGCACAATTACCATTCCCGAGGTTGCCCACGACACTGAAGAGGATGAGTACGTGTTTGATGTC
GATATAATCGCCGAAACTAAGGAGAAGGCCCCGGTAAAAGCCTTGGTGCGCTCCAAGATCCTGCCCCAACTGCGC
CAAACCTTCCAGAAGCTTGCTCCAGCATTGATAGCCGAGCACGGCAAAGACATCCAACACGCTGATGGCGAGAAC
CCTTCGAGTGGCTTTTCAACTCCAAAGCTCCATACCGGAACGACAACTCCTAGACCAATCGCACAGTCTTCGAGC
ACCACGTCAGCCATCGTCAACACGGTGACCGTAACGGACAATGAAGAGTTTCGAACCACGGCCGAGGAGATGTAT
CAGACCTTTGTCGACCCGGCCCGTATCGCCGCCTTTACCCGCTCGCCCCCTCAGGTTTTTGAAGGAGCCAAGGCT
GGTGGCAAGTTCAAACTCTTTGGTGGCAATGTCTCGGGCGAGTATATTGAGCTTGAGGCCCCAAACAAGATTATA
CAGAGCTGGCGCTTGAGCCAGTGGCCCGCCGGCCATCACTCGACTCTCAAGATTGAGTTTGATCAAAACGATATA
GACCATGTCACCGTCATGCGCGTTACTTGGGACGGTGTGCCCACGGGACAGGAGGAAGTGACCAAGCGCAATTGG
CTCGAGTACTACGTCAAGAGTATCAAACAGACTTTTGGCTTTGGAGCCATCTTGTAG
Transcript >OphauG2|546
ATGCTGCTGCTGCTGCTGCTTTTGCCTGCTCTCGTCACCTCAGCACCCTCCAGCCTCCAGCTTCCAGCCCGCCAC
ATTTCGTCCACCCCATCCGACCTCACCGCAGAGTGCTATTTGCCTGTCGCAACAGCTTTCCAATATCTAACTGCA
AGTCAATCAACCTCACTGGTCTCTCCCCCACTGCGCCCTGCTCAATCTACAAGCGTCGTCATGGTGCTGCACAAC
CCCAATAACTGGCACTGGGTCAACAAGGATGTGTCGCAATGGGCCAGAAAATGGTTCGAGGACAGTCTGGCAAAC
ATAGAGGCCGAGGATGGTCCTGTTACGGCCAAGATTAGCAGCGTCCAGAGCATGGACGGTGATGTCGATGTCAGC
CAGCGCAAGGGCAAAGTCATCACCATTTTTGATGTCAAGCTAGTTCTCGATTATACCGGCTCAGCTCCCGATGCT
GCGGATGTCTCTGGCACAATTACCATTCCCGAGGTTGCCCACGACACTGAAGAGGATGAGTACGTGTTTGATGTC
GATATAATCGCCGAAACTAAGGAGAAGGCCCCGGTAAAAGCCTTGGTGCGCTCCAAGATCCTGCCCCAACTGCGC
CAAACCTTCCAGAAGCTTGCTCCAGCATTGATAGCCGAGCACGGCAAAGACATCCAACACGCTGATGGCGAGAAC
CCTTCGAGTGGCTTTTCAACTCCAAAGCTCCATACCGGAACGACAACTCCTAGACCAATCGCACAGTCTTCGAGC
ACCACGTCAGCCATCGTCAACACGGTGACCGTAACGGACAATGAAGAGTTTCGAACCACGGCCGAGGAGATGTAT
CAGACCTTTGTCGACCCGGCCCGTATCGCCGCCTTTACCCGCTCGCCCCCTCAGGTTTTTGAAGGAGCCAAGGCT
GGTGGCAAGTTCAAACTCTTTGGTGGCAATGTCTCGGGCGAGTATATTGAGCTTGAGGCCCCAAACAAGATTATA
CAGAGCTGGCGCTTGAGCCAGTGGCCCGCCGGCCATCACTCGACTCTCAAGATTGAGTTTGATCAAAACGATATA
GACCATGTCACCGTCATGCGCGTTACTTGGGACGGTGTGCCCACGGGACAGGAGGAAGTGACCAAGCGCAATTGG
CTCGAGTACTACGTCAAGAGTATCAAACAGACTTTTGGCTTTGGAGCCATCTTGTAG
Gene >OphauG2|546
ATGCTGCTGCTGCTGCTGCTTTTGCCTGCTCTCGTCACCTCAGCACCCTCCAGCCTCCAGCTTCCAGCCCGCCAC
ATGTCGCGTATTCGTATTCGCCCCGCTTTTCCAAGCTCTCCCTCCCCCTTGGCTCTCTTTTGTCCACCTGGACGA
GATTCTAGAGCCTTCTGCCACGCTGCACTTTTCCCTTGCTCGACGCCCTTTGCAGTTCGTCCACCCCATCCGACC
TCACCGCAGAGTGCTATTTGCCTGTCGCAACAGCTTTCCAATATCTAACTGCAAGTCAATCAACCTCACTGGTAG
GCGCTCAACCCGCAATTCTGCTTCTTCCATGATGAGAACCCAGCTGGCACCAGTCATAGAGTGACTTGTACTCTC
TTCATTGATGACCAACATGCTGTGGCATAAGACCAACCTCTGATGCAACTTCTTTTTTTGATTCTTGTCCTCATC
TCGATTTAATCCCCCGATCAATACTAATTGCCACCTCTACAAGGTCTCTCCCCCACTGCGCCCTGCTCAATCTAC
AAGCGTCGTCATGGTGCTGCACAACCCCAATAACTGGCACTGGGTCAACAAGGATGTGTCGCAATGGGCCAGAAA
ATGGTTCGAGGACAGTCTGGCAAACATAGAGGCCGAGGATGGTCCTGTTACGGCCAAGATTAGCAGCGTCCAGAG
CATGGACGGTGATGTCGATGTCAGCCAGCGCAAGGGCAAAGTCATCACCATTTTTGATGTCAAGCTAGTTCTCGA
TTATACCGGTAAGCGGCGCCACGCCCGTTTCCCATTGCTCATCCATCTGACCCTACCAAGGCTCAGCTCCCGATG
CTGCGGATGTCTCTGGCACAATTACCATTCCCGAGGTTGCCCACGACACTGAAGAGGATGAGTACGTGGTACGTC
CAACATTATCCGCGACTGTCCTCTGCCTTGTACCCAATTTAATAAACCCTTGTCTGTAGTTTGATGTCGATATAA
TCGCCGAAACTAAGGAGAAGGCCCCGGTAAAAGCCTTGGTGCGCTCCAAGATCCTGCCCCAACTGCGCCAAACCT
TCCAGAAGCTTGCTCCAGCATTGATAGCCGAGCACGGCAAAGACATCCAACACGCTGATGGCGAGAACCCTTCGA
GTGGCTTTTCAACTCCAAAGCTCCATACCGGAACGACAACTCCTAGACCAATCGCACAGTCTTCGAGCACCACGT
CAGCCATCGTCAACACGGTGACCGTAACGGACAATGAAGAGTTTCGAACCACGGCCGAGGAGATGTATCAGACCT
TTGTCGACCCGGCCCGTATCGCCGCCTTTACCCGCTCGCCCCCTCAGGTTTTTGAAGGAGCCAAGGCTGGTGGCA
AGTTCAAACTCTTTGGTGGCAATGTCTCGGGCGAGTATATTGAGCTTGAGGCCCCAAACAAGATTATACAGAGCT
GGCGCTTGAGCCAGTGGCCCGCCGGCCATCACTCGACTCTCAAGATTGAGTTTGATCAAAACGATATAGACCATG
TCACCGTCATGCGCGTTACTTGGGACGGTGTGCCCACGGGACAGGAGGAAGTGACCAAGCGCAATTGGCTCGAGT
ACTACGTCAAGAGTATCAAACAGACTTTTGGGTAGGCCGTTGCAACCACTCATGCACTCTCAAACTGGGCATATA
CTAATTGTGGTACAGCTTTGGAGCCATCTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail