Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5457
Gene name
LocationContig_50:30023..32046
Strand+
Gene length (bp)2023
Transcript length (bp)1725
Coding sequence length (bp)1725
Protein length (aa) 575

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1427
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5457 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3007
Ophiocordyceps camponoti-floridani Ophcf2|07142
Ophiocordyceps camponoti-rufipedis Ophun1|7107
Ophiocordyceps kimflemingae Ophio5|2704
Ophiocordyceps subramaniannii Hirsu2|1093

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5457
MASLATSGGSTLGSGGRQIPLLCSVCPEAPRFSDVSHLLTHIASKGHLHHETQTRLKRNQDLASLALLEQYEQWY
RDNGIEALLVERMKAKQQKEAAKARRVRGAALAPANKSKRKTKRRSPNSTSATPAREAKLEQGDYIPDFALFPGF
LPSENDVDNQDDVFVSTDMLALKGQVWPGMGKMDLANEDMKRTRNQRKPNSVIDKMRRTSEGIEPTQVVMTPDFE
VERIKGVYDSSSPIPGQEEETPKKVIKPKRKRSEVLADVSVNVPRGGNRRSTRLSLASTNSSNSHKIKHLKLEYD
RDTSSDLTPSLGAFRHSHDIFRDDDGCHDRSFATPTHREPKFDTRERLSMHSLNPMSHSIVVSPTPSSREVSARI
LSARSRGPPRANLGHGGPLSLGGMSQPETVYGLADASMFGPPTRLAFAASPYNSLSQDGYRLLPSHLQAKQEDYS
STSSDSLSGSNNGSFLSMAETNPLFSQDRVFLPPYHPSNTNPSLSSMSFTPINRVQDHGHGSHDHDHRPQLPDIK
LENHICDGIESSTCTEKQGGLSMHAMWDSHGPGSGVGIRPELNDDEIDL*
Coding >OphauG2|5457
ATGGCGTCGCTGGCCACTTCGGGTGGCAGCACGCTCGGCTCAGGCGGCAGACAGATCCCGCTGCTCTGCAGTGTC
TGTCCTGAAGCTCCGCGCTTCTCAGACGTGTCCCATCTCTTGACGCACATTGCTTCCAAGGGCCACCTTCACCAT
GAAACCCAGACGCGACTCAAACGAAACCAGGATCTGGCTTCGTTGGCTCTTTTGGAGCAGTATGAGCAGTGGTAC
AGGGATAATGGCATCGAGGCTTTGTTGGTGGAGAGGATGAAGGCAAAGCAGCAGAAGGAAGCTGCCAAGGCCAGG
CGCGTTCGTGGAGCCGCCTTGGCGCCTGCAAACAAATCCAAGCGCAAGACGAAGCGGCGTTCGCCCAACTCCACC
AGTGCAACACCTGCCAGGGAGGCCAAGTTGGAGCAGGGCGACTATATACCCGACTTTGCCCTATTTCCTGGATTT
CTTCCGTCTGAAAACGATGTGGACAATCAAGACGACGTCTTTGTAAGCACTGACATGCTTGCCCTCAAGGGCCAG
GTGTGGCCTGGTATGGGCAAGATGGATCTTGCCAATGAAGACATGAAACGAACGCGCAACCAGCGCAAGCCCAAT
TCTGTCATCGATAAGATGCGGAGAACGTCTGAAGGCATTGAGCCCACCCAGGTGGTTATGACCCCTGATTTTGAG
GTGGAAAGGATCAAGGGAGTATACGATAGCTCTTCTCCCATTCCTGGCCAAGAAGAAGAGACGCCAAAGAAGGTG
ATTAAGCCCAAGCGCAAGAGGTCCGAGGTGCTCGCAGATGTCTCCGTAAACGTTCCTCGTGGCGGAAATCGACGC
TCGACTCGTCTTAGTCTGGCGAGCACTAATAGCAGTAACAGCCACAAAATAAAGCATCTCAAGCTCGAATATGAC
CGCGATACAAGCTCCGATCTGACTCCATCCCTCGGCGCATTCCGCCATAGCCACGACATTTTCCGCGACGATGAT
GGATGCCATGACCGTTCCTTTGCGACGCCTACTCACCGGGAACCCAAATTCGACACCCGAGAGCGATTGAGCATG
CATTCTCTAAATCCCATGTCCCACTCCATTGTTGTCTCACCTACTCCCTCGTCGAGAGAAGTATCGGCTCGTATC
CTCTCGGCGAGAAGCAGAGGTCCGCCGCGCGCAAATCTTGGTCATGGCGGCCCTTTGTCTCTAGGTGGCATGTCA
CAGCCCGAGACAGTATATGGCCTCGCAGATGCATCCATGTTTGGTCCTCCAACAAGACTTGCCTTTGCTGCAAGT
CCTTACAACAGCCTATCACAAGATGGATATCGCCTCCTTCCTAGTCACTTGCAGGCCAAGCAGGAGGACTATTCG
TCGACAAGCAGTGACTCGCTATCTGGGTCCAACAATGGATCCTTCTTGTCAATGGCTGAGACGAACCCACTCTTC
TCCCAGGACCGAGTTTTTCTACCTCCATACCATCCATCCAACACTAACCCGTCTCTATCATCTATGAGCTTCACA
CCCATCAACAGAGTTCAGGATCACGGGCATGGATCCCACGATCATGATCACCGGCCACAGCTACCCGATATTAAG
CTCGAAAATCACATTTGCGATGGCATCGAGAGTAGCACCTGTACAGAAAAACAAGGCGGATTATCCATGCACGCC
ATGTGGGACTCACATGGTCCTGGTAGCGGTGTTGGCATTCGCCCTGAGCTCAACGACGACGAGATTGACTTATAA
Transcript >OphauG2|5457
ATGGCGTCGCTGGCCACTTCGGGTGGCAGCACGCTCGGCTCAGGCGGCAGACAGATCCCGCTGCTCTGCAGTGTC
TGTCCTGAAGCTCCGCGCTTCTCAGACGTGTCCCATCTCTTGACGCACATTGCTTCCAAGGGCCACCTTCACCAT
GAAACCCAGACGCGACTCAAACGAAACCAGGATCTGGCTTCGTTGGCTCTTTTGGAGCAGTATGAGCAGTGGTAC
AGGGATAATGGCATCGAGGCTTTGTTGGTGGAGAGGATGAAGGCAAAGCAGCAGAAGGAAGCTGCCAAGGCCAGG
CGCGTTCGTGGAGCCGCCTTGGCGCCTGCAAACAAATCCAAGCGCAAGACGAAGCGGCGTTCGCCCAACTCCACC
AGTGCAACACCTGCCAGGGAGGCCAAGTTGGAGCAGGGCGACTATATACCCGACTTTGCCCTATTTCCTGGATTT
CTTCCGTCTGAAAACGATGTGGACAATCAAGACGACGTCTTTGTAAGCACTGACATGCTTGCCCTCAAGGGCCAG
GTGTGGCCTGGTATGGGCAAGATGGATCTTGCCAATGAAGACATGAAACGAACGCGCAACCAGCGCAAGCCCAAT
TCTGTCATCGATAAGATGCGGAGAACGTCTGAAGGCATTGAGCCCACCCAGGTGGTTATGACCCCTGATTTTGAG
GTGGAAAGGATCAAGGGAGTATACGATAGCTCTTCTCCCATTCCTGGCCAAGAAGAAGAGACGCCAAAGAAGGTG
ATTAAGCCCAAGCGCAAGAGGTCCGAGGTGCTCGCAGATGTCTCCGTAAACGTTCCTCGTGGCGGAAATCGACGC
TCGACTCGTCTTAGTCTGGCGAGCACTAATAGCAGTAACAGCCACAAAATAAAGCATCTCAAGCTCGAATATGAC
CGCGATACAAGCTCCGATCTGACTCCATCCCTCGGCGCATTCCGCCATAGCCACGACATTTTCCGCGACGATGAT
GGATGCCATGACCGTTCCTTTGCGACGCCTACTCACCGGGAACCCAAATTCGACACCCGAGAGCGATTGAGCATG
CATTCTCTAAATCCCATGTCCCACTCCATTGTTGTCTCACCTACTCCCTCGTCGAGAGAAGTATCGGCTCGTATC
CTCTCGGCGAGAAGCAGAGGTCCGCCGCGCGCAAATCTTGGTCATGGCGGCCCTTTGTCTCTAGGTGGCATGTCA
CAGCCCGAGACAGTATATGGCCTCGCAGATGCATCCATGTTTGGTCCTCCAACAAGACTTGCCTTTGCTGCAAGT
CCTTACAACAGCCTATCACAAGATGGATATCGCCTCCTTCCTAGTCACTTGCAGGCCAAGCAGGAGGACTATTCG
TCGACAAGCAGTGACTCGCTATCTGGGTCCAACAATGGATCCTTCTTGTCAATGGCTGAGACGAACCCACTCTTC
TCCCAGGACCGAGTTTTTCTACCTCCATACCATCCATCCAACACTAACCCGTCTCTATCATCTATGAGCTTCACA
CCCATCAACAGAGTTCAGGATCACGGGCATGGATCCCACGATCATGATCACCGGCCACAGCTACCCGATATTAAG
CTCGAAAATCACATTTGCGATGGCATCGAGAGTAGCACCTGTACAGAAAAACAAGGCGGATTATCCATGCACGCC
ATGTGGGACTCACATGGTCCTGGTAGCGGTGTTGGCATTCGCCCTGAGCTCAACGACGACGAGATTGACTTATAA
Gene >OphauG2|5457
ATGGCGTCGCTGGCCACTTCGGGTGGCAGCACGCTCGGCTCAGGCGGCAGACAGATCCCGCTGCTCTGCAGTGTC
TGTCCTGAAGCTCCGCGCTTCTCAGACGTGTCCCATCTCTTGACGCACATTGCTTCCAAGGGCCACCTTCACCAT
GAAACCCAGACGCGACTCAAACGAAACCAGGATCTGGCTTCGTTGGCTCTTTTGGAGCAGTATGAGCAGTGGTAC
AGGGATAATGGCATCGAGGCTTTGTTGGTGGAGAGGATGAAGGCAAAGCAGCAGAAGGAAGCTGCCAAGGCCAGG
CGCGTTCGTGGAGCCGCCTTGGCGCCTGCAAACAAAGTTGGTTCTTCTTCGTCTTGAGTCTTGACCGTCAGTACT
AATCTCATGTCTGCCATAGTCCAAGCGCAAGACGAAGCGGCGTTCGCCCAACTCCACCAGTGCAACACCTGCCAG
GGAGGCCAAGTTGGAGCAGGGCGACTATATACCCGACTTTGCCCTATTTCCTGGATTTCTTCCGTCTGAAAACGA
TGTGGACAATCAAGACGACGTCTTTGTAAGCACTGACATGCTTGCCCTCAAGGGCCAGGTGTGGCCTGGTATGGG
CAAGATGGATCTTGCCAATGAAGACATGAAACGAACGCGCAACCAGCGCAAGCCCAATTCTGTCATCGATAAGAT
GCGGAGAACGTCTGAAGGCATTGAGCCCACCCAGGTGGTTATGACCCCTGATTTTGAGGTGGAAAGGATCAAGGG
AGTATACGATAGCTCTTCTCCCATTCCTGGCCAAGAAGAAGAGGTGTGTGCCGCGTCAGTGGCTCGGTCTATGTG
ACCCTCACTCAGCTCATGGTTTGCAGACGCCAAAGAAGGTGATTAAGCCCAAGCGCAAGAGGTCCGAGGTGCTCG
CAGATGTCTCCGTAAACGTTCCTCGTGGCGGAAATCGACGCTCGACTCGTCTTAGTCTGGCGAGCACTAATAGCA
GTAACAGCCACAAAATAAAGCATCTCAAGCTCGAATATGACCGCGATACAAGCTCCGATCTGACTCCATCCCTCG
GCGCATTCCGCCATAGCCACGACATTTTCCGCGACGATGATGGATGCCATGGTATGCGCTCTTTTCATTTTCCAG
GTCAATTTCTGACTTGACGCAGGCTCATATGCAGACCGTTCCTTTGCGACGCCTACTCACCGGGAACCCAAGTAT
GCGCTTTGCCGTCGATTATTGACTTGGAGCCATCGCTTACCAGACTCCAGATTCGACACCCGAGAGCGATTGAGC
ATGCATTCTCTAAATCCCATGTCCCACTCCATTGTTGTCTCACCTACTCCCTCGTCGAGAGAAGTATCGGCTCGT
ATCCTCTCGGCGAGAAGCAGAGGTCCGCCGCGCGCAAATCTTGGTCATGGCGGCCCTTTGTCTCTAGGTAAGACA
GCCTTGTGTCGTCTGAAGAGTGCTATTTTCTTGTCCAGGACGTCTTTTTGACAAAAGCTCAGGTGGCATGTCACA
GCCCGAGACAGTATATGGCCTCGCAGATGCATCCATGTTTGGTCCTCCAACAAGACTTGCCTTTGCTGCAAGTCC
TTACAACAGCCTATCACAAGATGGATATCGCCTCCTTCCTAGTCACTTGCAGGCCAAGCAGGAGGACTATTCGTC
GACAAGCAGTGACTCGCTATCTGGGTCCAACAATGGATCCTTCTTGTCAATGGCTGAGACGAACCCACTCTTCTC
CCAGGACCGAGTTTTTCTACCTCCATACCATCCATCCAACACTAACCCGTCTCTATCATCTATGAGCTTCACACC
CATCAACAGAGTTCAGGATCACGGGCATGGATCCCACGATCATGATCACCGGCCACAGCTACCCGATATTAAGCT
CGAAAATCACATTTGCGATGGCATCGAGAGTAGCACCTGTACAGAAAAACAAGGCGGATTATCCATGCACGCCAT
GTGGGACTCACATGGTCCTGGTAGCGGTGTTGGCATTCGCCCTGAGCTCAACGACGACGAGATTGACTTATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail