Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5455
Gene name
LocationContig_50:20977..23118
Strand-
Gene length (bp)2141
Transcript length (bp)1920
Coding sequence length (bp)1920
Protein length (aa) 640

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00620 RhoGAP RhoGAP domain 4.1E-29 363 505

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10164|RGA2_SCHPO Probable Rho-type GTPase-activating protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga2 PE=1 SV=1 362 530 3.0E-20
sp|P32873|BEM3_YEAST GTPase-activating protein BEM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BEM3 PE=1 SV=3 350 525 8.0E-18
sp|Q62796|RBP1_RAT RalA-binding protein 1 OS=Rattus norvegicus GN=Ralbp1 PE=1 SV=3 362 523 4.0E-15
sp|Q74ZH7|BEM3_ASHGO GTPase-activating protein BEM3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BEM3 PE=3 SV=2 359 526 5.0E-15
sp|Q15311|RBP1_HUMAN RalA-binding protein 1 OS=Homo sapiens GN=RALBP1 PE=1 SV=3 362 507 7.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10164|RGA2_SCHPO Probable Rho-type GTPase-activating protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga2 PE=1 SV=1 362 530 3.0E-20
sp|P32873|BEM3_YEAST GTPase-activating protein BEM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BEM3 PE=1 SV=3 350 525 8.0E-18
sp|Q62796|RBP1_RAT RalA-binding protein 1 OS=Rattus norvegicus GN=Ralbp1 PE=1 SV=3 362 523 4.0E-15
sp|Q74ZH7|BEM3_ASHGO GTPase-activating protein BEM3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BEM3 PE=3 SV=2 359 526 5.0E-15
sp|Q15311|RBP1_HUMAN RalA-binding protein 1 OS=Homo sapiens GN=RALBP1 PE=1 SV=3 362 507 7.0E-15
sp|Q54FG5|GACJJ_DICDI Rho GTPase-activating protein gacJJ OS=Dictyostelium discoideum GN=gacJJ PE=3 SV=1 362 505 2.0E-14
sp|Q62172|RBP1_MOUSE RalA-binding protein 1 OS=Mus musculus GN=Ralbp1 PE=1 SV=4 362 523 5.0E-14
sp|Q9HF75|BEM2_ASHGO GTPase-activating protein BEM2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BEM2 PE=3 SV=1 362 501 5.0E-14
sp|Q8BL80|RHG22_MOUSE Rho GTPase-activating protein 22 OS=Mus musculus GN=Arhgap22 PE=1 SV=2 332 503 1.0E-13
sp|O94988|FA13A_HUMAN Protein FAM13A OS=Homo sapiens GN=FAM13A PE=1 SV=2 332 541 3.0E-13
sp|A2RUV4|RHG21_XENTR Rho GTPase-activating protein 21 OS=Xenopus tropicalis GN=arhgap21 PE=2 SV=1 376 505 8.0E-13
sp|Q5T5U3|RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens GN=ARHGAP21 PE=1 SV=1 358 545 2.0E-12
sp|Q7Z5H3|RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens GN=ARHGAP22 PE=1 SV=1 332 503 3.0E-12
sp|Q71M21|RH21B_XENLA Rho GTPase-activating protein 21-B OS=Xenopus laevis GN=arhgap21-b PE=2 SV=1 376 505 3.0E-12
sp|Q54TH9|GACY_DICDI Rho GTPase-activating protein gacY OS=Dictyostelium discoideum GN=gacY PE=3 SV=1 362 508 5.0E-12
sp|Q69ZH9|RHG23_MOUSE Rho GTPase-activating protein 23 OS=Mus musculus GN=Arhgap23 PE=1 SV=2 350 505 5.0E-12
sp|Q6DFV3|RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus GN=Arhgap21 PE=1 SV=1 358 545 8.0E-12
sp|P83509|RHG35_CANLF Rho GTPase-activating protein 35 OS=Canis lupus familiaris GN=ARHGAP35 PE=2 SV=1 362 505 1.0E-11
sp|Q6DFG0|RH21A_XENLA Rho GTPase-activating protein 21-A OS=Xenopus laevis GN=arhgap21-a PE=2 SV=1 376 505 2.0E-11
sp|Q91YM2|RHG35_MOUSE Rho GTPase-activating protein 35 OS=Mus musculus GN=Arhgap35 PE=1 SV=3 362 505 2.0E-11
sp|P81128|RHG35_RAT Rho GTPase-activating protein 35 OS=Rattus norvegicus GN=Arhgap35 PE=1 SV=2 362 505 2.0E-11
sp|Q9NRY4|RHG35_HUMAN Rho GTPase-activating protein 35 OS=Homo sapiens GN=ARHGAP35 PE=1 SV=3 362 505 2.0E-11
sp|Q9P227|RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens GN=ARHGAP23 PE=1 SV=2 350 505 3.0E-11
sp|Q5VT97|SYDE2_HUMAN Rho GTPase-activating protein SYDE2 OS=Homo sapiens GN=SYDE2 PE=1 SV=2 347 505 3.0E-11
sp|O43295|SRGP3_HUMAN SLIT-ROBO Rho GTPase-activating protein 3 OS=Homo sapiens GN=SRGAP3 PE=1 SV=3 362 505 7.0E-11
sp|P38339|RGD1_YEAST RHO GTPase-activating protein RGD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGD1 PE=1 SV=1 362 505 8.0E-11
sp|Q811P8|RHG32_MOUSE Rho GTPase-activating protein 32 OS=Mus musculus GN=Arhgap32 PE=1 SV=2 360 512 9.0E-11
sp|Q55DW9|GACZ_DICDI Rho GTPase-activating protein gacZ OS=Dictyostelium discoideum GN=gacZ PE=3 SV=1 351 523 1.0E-10
sp|A7KAX9|RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens GN=ARHGAP32 PE=1 SV=1 380 512 1.0E-10
sp|Q13017|RHG05_HUMAN Rho GTPase-activating protein 5 OS=Homo sapiens GN=ARHGAP5 PE=1 SV=2 362 505 1.0E-10
sp|Q812A2|SRGP3_MOUSE SLIT-ROBO Rho GTPase-activating protein 3 OS=Mus musculus GN=Srgap3 PE=1 SV=1 362 505 2.0E-10
sp|Q9PT60|RBP1A_XENLA RalA-binding protein 1-A OS=Xenopus laevis GN=ralbp1-a PE=1 SV=3 333 527 2.0E-10
sp|B2RTY4|MYO9A_HUMAN Unconventional myosin-IXa OS=Homo sapiens GN=MYO9A PE=1 SV=2 339 505 2.0E-10
sp|P97393|RHG05_MOUSE Rho GTPase-activating protein 5 OS=Mus musculus GN=Arhgap5 PE=1 SV=2 362 505 2.0E-10
sp|Q9Z1N3|MYO9A_RAT Unconventional myosin-IXa OS=Rattus norvegicus GN=Myo9a PE=1 SV=1 339 505 3.0E-10
sp|P39960|BEM2_YEAST GTPase-activating protein BEM2/IPL2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BEM2 PE=1 SV=1 351 501 3.0E-10
sp|Q54G18|GACW_DICDI Rho GTPase-activating protein gacW OS=Dictyostelium discoideum GN=gacW PE=3 SV=1 362 523 3.0E-10
sp|Q640N3|RHG30_MOUSE Rho GTPase-activating protein 30 OS=Mus musculus GN=Arhgap30 PE=1 SV=3 380 503 3.0E-10
sp|Q6TLK4|RHG27_RAT Rho GTPase-activating protein 27 OS=Rattus norvegicus GN=Arhgap27 PE=1 SV=1 362 505 4.0E-10
sp|Q8C170|MYO9A_MOUSE Unconventional myosin-IXa OS=Mus musculus GN=Myo9a PE=1 SV=2 339 505 5.0E-10
sp|Q6GPD0|RHG32_XENLA Rho GTPase-activating protein 32 OS=Xenopus laevis GN=arhgap32 PE=2 SV=1 380 512 6.0E-10
sp|A2AB59|RHG27_MOUSE Rho GTPase-activating protein 27 OS=Mus musculus GN=Arhgap27 PE=1 SV=1 362 505 9.0E-10
sp|Q8N264|RHG24_HUMAN Rho GTPase-activating protein 24 OS=Homo sapiens GN=ARHGAP24 PE=1 SV=2 363 503 1.0E-09
sp|Q7Z6I6|RHG30_HUMAN Rho GTPase-activating protein 30 OS=Homo sapiens GN=ARHGAP30 PE=1 SV=3 380 503 1.0E-09
sp|Q8C4V1|RHG24_MOUSE Rho GTPase-activating protein 24 OS=Mus musculus GN=Arhgap24 PE=1 SV=2 363 503 1.0E-09
sp|Q5U2Z7|RHG24_RAT Rho GTPase-activating protein 24 OS=Rattus norvegicus GN=Arhgap24 PE=1 SV=2 363 503 2.0E-09
sp|Q53QZ3|RHG15_HUMAN Rho GTPase-activating protein 15 OS=Homo sapiens GN=ARHGAP15 PE=1 SV=2 362 505 2.0E-09
sp|Q6ZUM4|RHG27_HUMAN Rho GTPase-activating protein 27 OS=Homo sapiens GN=ARHGAP27 PE=1 SV=3 362 505 3.0E-09
sp|Q54C77|Y3184_DICDI Probable inactive serine/threonine-protein kinase DDB_G0293184 OS=Dictyostelium discoideum GN=DDB_G0293184 PE=3 SV=1 362 516 5.0E-09
sp|A4IF90|RHG15_BOVIN Rho GTPase-activating protein 15 OS=Bos taurus GN=ARHGAP15 PE=2 SV=1 362 505 7.0E-09
sp|P34288|PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans GN=pac-1 PE=1 SV=4 362 505 9.0E-09
sp|Q55DK5|MGP3_DICDI Mental retardation GTPase activating protein homolog 3 OS=Dictyostelium discoideum GN=mgp3 PE=3 SV=1 381 521 1.0E-08
sp|Q9V9S7|SYDE_DROME Rho GTPase-activating protein 100F OS=Drosophila melanogaster GN=RhoGAP100F PE=1 SV=2 362 507 1.0E-08
sp|Q2M1Z3|RHG31_HUMAN Rho GTPase-activating protein 31 OS=Homo sapiens GN=ARHGAP31 PE=1 SV=2 371 505 2.0E-08
sp|B0S6J3|SRGP2_DANRE SLIT-ROBO Rho GTPase-activating protein 2 OS=Danio rerio GN=srgap2 PE=2 SV=1 362 505 2.0E-08
sp|Q811M1|RHG15_MOUSE Rho GTPase-activating protein 15 OS=Mus musculus GN=Arhgap15 PE=1 SV=1 362 505 2.0E-08
sp|A6X8Z5|RHG31_MOUSE Rho GTPase-activating protein 31 OS=Mus musculus GN=Arhgap31 PE=1 SV=1 371 534 3.0E-08
sp|Q7Z6B7|SRGP1_HUMAN SLIT-ROBO Rho GTPase-activating protein 1 OS=Homo sapiens GN=SRGAP1 PE=1 SV=1 362 505 4.0E-08
sp|Q54QF4|MGP4_DICDI Mental retardation GTPase activating protein homolog 4 OS=Dictyostelium discoideum GN=mgp4 PE=3 SV=1 374 521 4.0E-08
sp|Q91Z69|SRGP1_MOUSE SLIT-ROBO Rho GTPase-activating protein 1 OS=Mus musculus GN=Srgap1 PE=1 SV=2 362 505 4.0E-08
sp|Q80YF9|RHG33_MOUSE Rho GTPase-activating protein 33 OS=Mus musculus GN=Arhgap33 PE=1 SV=1 371 505 4.0E-08
sp|O14559|RHG33_HUMAN Rho GTPase-activating protein 33 OS=Homo sapiens GN=ARHGAP33 PE=1 SV=2 380 503 7.0E-08
sp|Q55CK2|MGP2_DICDI Mental retardation GTPase activating protein homolog 2 OS=Dictyostelium discoideum GN=mgp2 PE=3 SV=1 376 505 1.0E-07
sp|Q9VX32|RG190_DROME Rho GTPase-activating protein 190 OS=Drosophila melanogaster GN=RhoGAPp190 PE=1 SV=2 362 505 1.0E-07
sp|O94466|RGA7_SCHPO Probable Rho-GTPase-activating protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga7 PE=1 SV=1 377 505 1.0E-07
sp|O74360|RGA4_SCHPO Probable Rho-type GTPase-activating protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga4 PE=1 SV=2 358 508 2.0E-07
sp|P46941|TG325_CAEEL WW domain-containing protein tag-325 OS=Caenorhabditis elegans GN=tag-325 PE=3 SV=1 362 505 2.0E-07
sp|Q8SSN9|GACF_DICDI Rho GTPase-activating protein gacF OS=Dictyostelium discoideum GN=gacF PE=3 SV=2 362 515 3.0E-07
sp|Q9CXP4|RHG08_MOUSE Rho GTPase-activating protein 8 OS=Mus musculus GN=Arhgap8 PE=2 SV=3 347 501 5.0E-07
sp|Q86I31|GACFF_DICDI Rho GTPase-activating protein gacFF OS=Dictyostelium discoideum GN=gacFF PE=2 SV=1 347 506 6.0E-07
sp|Q9VIS1|CDGAP_DROME GTPase-activating protein CdGAPr OS=Drosophila melanogaster GN=CdGAPr PE=1 SV=2 380 505 8.0E-07
sp|Q54NL0|GACT_DICDI Rho GTPase-activating protein gacT OS=Dictyostelium discoideum GN=gacT PE=3 SV=1 362 580 1.0E-06
sp|Q55GP8|GACO_DICDI Rho GTPase-activating protein gacO OS=Dictyostelium discoideum GN=gacO PE=3 SV=1 347 505 2.0E-06
sp|O43182|RHG06_HUMAN Rho GTPase-activating protein 6 OS=Homo sapiens GN=ARHGAP6 PE=1 SV=3 313 505 6.0E-06
sp|P30337|CHIN_RAT N-chimaerin OS=Rattus norvegicus GN=Chn1 PE=1 SV=2 376 505 8.0E-06
sp|Q91V57|CHIN_MOUSE N-chimaerin OS=Mus musculus GN=Chn1 PE=1 SV=2 376 505 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0050789 regulation of biological process No
GO:0008150 biological_process No
GO:0065007 biological regulation No
GO:0050794 regulation of cellular process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5455
MGRKPTPQPLTLADNSTPLDSVSIADTTHPQAQVAAQSLASASKSPTSLRSPRSPASSQTPRQLHAGKPTLHFGD
EELEQTTPSHDNASTPIDNQGLASSPASPFQPVMRHAATEFKKPTKSGFFHFSKTSRAANQLLNPTALHQNEPPD
RATSSGSDGAVALSHQDPPSFHDASQKPSTPVPSRSDLSISSGDQESGTTTSSAKKTRQKTFGFLGRGKTKLENK
ENDSPPPVLQDNAFDDMINSKSTRNRSQDRTPSRDAVSVKNGSRERDLRHGPTSSKDTSALTFLSGLRNSSTRAA
DMISKGIFGKGSRSSNTTDKETIIDDEHYTLKVITLPLVEQTRLTRISKRLEKSRDKTEFWMPAFPWRAIDYLNY
KGCDVEGLYRVPGSGPQIKKWQRRFDEQYDVNLFDAKDLYDINIIGSMLKAWLRELPDELLPKEAQDRIARECAG
SIEVPQMLVDELSNLSPFNYYLLFAITCHLSLLLAHSEKNKMDFRNLCICFQPCMKIDAFCFKFLVCDWRDCWKG
CKNEAKYIEEEYTLFEQPLPRRMSEPRPARQTDRYDERQLSSPSSVAHSTSGQGNRPARSKKHGHQLSDSNASVG
SNISSVSTSLSNSIDRDTAEGSKDLRRLSPIKPLSPIGF*
Coding >OphauG2|5455
ATGGGACGCAAGCCCACGCCGCAGCCGCTCACGCTGGCCGACAACTCTACACCTCTAGATAGCGTCTCCATCGCC
GACACGACGCATCCTCAAGCCCAAGTGGCTGCCCAGAGTCTTGCATCCGCCTCCAAGTCTCCCACTTCGTTACGC
TCTCCCCGCTCTCCTGCTAGTAGTCAAACGCCCCGGCAGTTGCATGCTGGCAAGCCCACATTGCATTTCGGTGAT
GAAGAGCTTGAGCAAACAACCCCCTCGCATGACAATGCTTCGACTCCCATTGATAATCAAGGTCTCGCATCGTCT
CCTGCCTCGCCATTCCAACCAGTAATGCGCCATGCAGCGACGGAGTTCAAGAAGCCTACAAAGTCTGGCTTTTTT
CACTTCAGCAAAACTTCTAGAGCCGCTAATCAGCTGCTGAACCCAACCGCCCTCCATCAGAACGAGCCACCTGAT
CGTGCCACTTCGTCAGGCAGTGACGGAGCCGTCGCCTTGAGCCACCAAGATCCTCCCTCTTTTCATGACGCTTCT
CAAAAACCCTCAACTCCGGTACCCTCACGCTCCGACCTCTCCATTTCATCAGGAGACCAAGAATCAGGTACAACA
ACGTCATCAGCTAAAAAGACTAGGCAAAAGACTTTTGGATTTTTGGGTCGTGGCAAGACAAAATTAGAGAACAAA
GAGAACGATAGTCCACCCCCAGTCCTCCAAGACAACGCCTTCGACGACATGATAAACTCGAAATCCACTCGAAAC
CGATCTCAAGATCGGACACCAAGCCGTGACGCCGTCTCCGTCAAGAACGGCTCCCGCGAAAGGGATCTTCGCCAC
GGACCGACATCCTCTAAAGACACTAGCGCTCTAACTTTTCTCAGCGGTCTCAGAAACTCCTCGACACGTGCTGCA
GACATGATATCTAAAGGTATATTCGGAAAGGGCTCGCGAAGTAGCAATACCACAGACAAAGAAACCATCATTGAT
GACGAGCATTATACCCTCAAAGTCATCACCTTGCCTCTGGTAGAACAGACTCGCTTGACTCGCATCTCAAAGCGG
CTTGAAAAGTCGCGAGACAAGACAGAGTTTTGGATGCCCGCTTTTCCCTGGAGAGCAATCGACTATCTCAATTAC
AAGGGCTGCGACGTTGAAGGTCTCTATCGCGTTCCAGGAAGCGGTCCGCAGATCAAGAAATGGCAGCGAAGATTT
GATGAGCAATACGATGTAAACTTGTTTGATGCAAAGGACTTGTACGACATCAACATTATTGGCTCAATGCTCAAG
GCATGGCTTCGAGAGCTTCCTGACGAGCTACTACCCAAAGAGGCTCAAGACCGCATCGCGAGAGAATGTGCAGGC
TCGATCGAGGTGCCGCAGATGCTCGTTGATGAGCTGTCAAACCTATCGCCCTTCAACTATTACCTTCTTTTTGCC
ATCACTTGCCATCTGAGTCTTCTTCTCGCGCACTCGGAGAAGAACAAGATGGATTTTCGAAACTTGTGCATATGT
TTCCAGCCATGCATGAAGATTGACGCCTTTTGCTTCAAGTTCCTCGTGTGCGACTGGAGAGACTGCTGGAAGGGC
TGCAAAAATGAAGCAAAATACATTGAGGAGGAATATACGCTATTTGAACAGCCCCTACCCCGGCGCATGTCAGAA
CCTCGTCCAGCGCGGCAGACTGATAGGTACGATGAGCGCCAGCTTTCATCTCCGAGCAGCGTCGCACATTCGACC
AGTGGACAGGGCAACCGGCCAGCGCGCTCCAAGAAGCATGGCCATCAGTTATCCGACTCCAACGCGAGCGTGGGC
TCAAACATTTCGTCGGTGTCGACCAGCCTGAGCAACAGCATCGATCGCGACACGGCTGAAGGGTCCAAAGACCTT
CGTCGCTTGTCGCCAATCAAGCCCTTATCGCCCATTGGTTTCTAA
Transcript >OphauG2|5455
ATGGGACGCAAGCCCACGCCGCAGCCGCTCACGCTGGCCGACAACTCTACACCTCTAGATAGCGTCTCCATCGCC
GACACGACGCATCCTCAAGCCCAAGTGGCTGCCCAGAGTCTTGCATCCGCCTCCAAGTCTCCCACTTCGTTACGC
TCTCCCCGCTCTCCTGCTAGTAGTCAAACGCCCCGGCAGTTGCATGCTGGCAAGCCCACATTGCATTTCGGTGAT
GAAGAGCTTGAGCAAACAACCCCCTCGCATGACAATGCTTCGACTCCCATTGATAATCAAGGTCTCGCATCGTCT
CCTGCCTCGCCATTCCAACCAGTAATGCGCCATGCAGCGACGGAGTTCAAGAAGCCTACAAAGTCTGGCTTTTTT
CACTTCAGCAAAACTTCTAGAGCCGCTAATCAGCTGCTGAACCCAACCGCCCTCCATCAGAACGAGCCACCTGAT
CGTGCCACTTCGTCAGGCAGTGACGGAGCCGTCGCCTTGAGCCACCAAGATCCTCCCTCTTTTCATGACGCTTCT
CAAAAACCCTCAACTCCGGTACCCTCACGCTCCGACCTCTCCATTTCATCAGGAGACCAAGAATCAGGTACAACA
ACGTCATCAGCTAAAAAGACTAGGCAAAAGACTTTTGGATTTTTGGGTCGTGGCAAGACAAAATTAGAGAACAAA
GAGAACGATAGTCCACCCCCAGTCCTCCAAGACAACGCCTTCGACGACATGATAAACTCGAAATCCACTCGAAAC
CGATCTCAAGATCGGACACCAAGCCGTGACGCCGTCTCCGTCAAGAACGGCTCCCGCGAAAGGGATCTTCGCCAC
GGACCGACATCCTCTAAAGACACTAGCGCTCTAACTTTTCTCAGCGGTCTCAGAAACTCCTCGACACGTGCTGCA
GACATGATATCTAAAGGTATATTCGGAAAGGGCTCGCGAAGTAGCAATACCACAGACAAAGAAACCATCATTGAT
GACGAGCATTATACCCTCAAAGTCATCACCTTGCCTCTGGTAGAACAGACTCGCTTGACTCGCATCTCAAAGCGG
CTTGAAAAGTCGCGAGACAAGACAGAGTTTTGGATGCCCGCTTTTCCCTGGAGAGCAATCGACTATCTCAATTAC
AAGGGCTGCGACGTTGAAGGTCTCTATCGCGTTCCAGGAAGCGGTCCGCAGATCAAGAAATGGCAGCGAAGATTT
GATGAGCAATACGATGTAAACTTGTTTGATGCAAAGGACTTGTACGACATCAACATTATTGGCTCAATGCTCAAG
GCATGGCTTCGAGAGCTTCCTGACGAGCTACTACCCAAAGAGGCTCAAGACCGCATCGCGAGAGAATGTGCAGGC
TCGATCGAGGTGCCGCAGATGCTCGTTGATGAGCTGTCAAACCTATCGCCCTTCAACTATTACCTTCTTTTTGCC
ATCACTTGCCATCTGAGTCTTCTTCTCGCGCACTCGGAGAAGAACAAGATGGATTTTCGAAACTTGTGCATATGT
TTCCAGCCATGCATGAAGATTGACGCCTTTTGCTTCAAGTTCCTCGTGTGCGACTGGAGAGACTGCTGGAAGGGC
TGCAAAAATGAAGCAAAATACATTGAGGAGGAATATACGCTATTTGAACAGCCCCTACCCCGGCGCATGTCAGAA
CCTCGTCCAGCGCGGCAGACTGATAGGTACGATGAGCGCCAGCTTTCATCTCCGAGCAGCGTCGCACATTCGACC
AGTGGACAGGGCAACCGGCCAGCGCGCTCCAAGAAGCATGGCCATCAGTTATCCGACTCCAACGCGAGCGTGGGC
TCAAACATTTCGTCGGTGTCGACCAGCCTGAGCAACAGCATCGATCGCGACACGGCTGAAGGGTCCAAAGACCTT
CGTCGCTTGTCGCCAATCAAGCCCTTATCGCCCATTGGTTTCTAA
Gene >OphauG2|5455
ATGGGACGCAAGCCCACGCCGCAGCCGCTCACGCTGGCCGACAACTCTACACCTCTAGATAGCGTCTCCATCGCC
GACACGACGCATCCTCAAGCCCAAGTGGCTGCCCAGAGTCTTGCATCCGCCTCCAAGTCTCCCACTTCGTTACGC
TCTCCCCGCTCTCCTGCTAGTAGTCAAACGCCCCGGCAGTTGCATGCTGGCAAGCCCACATTGCATTTCGGTGAT
GAAGAGCTTGAGCAAACAACCCCCTCGCATGACAATGCTTCGACTCCCATTGATAATCAAGGTCTCGCATCGTCT
CCTGCCTCGCCATTCCAACCAGTAATGCGCCATGCAGCGACGGAGTTCAAGAAGCCTACAAAGTCTGGCTTTTTT
CACTTCAGCAAAACTTCTAGAGCCGCTAATCAGCTGCTGAACCCAACCGCCCTCCATCAGAACGAGCCACCTGAT
CGTGCCACTTCGTCAGGCAGTGACGGAGCCGTCGCCTTGAGCCACCAAGGTATGTATGCTCAAATGTCTATTGCG
GCGTGCCCGCAGACTCTGATTTCGTGTCCATCAACCTGAAGTGCCTCTTCTGATCCACTCACTAGATCCTCCCTC
TTTTCATGACGCTTCTCAAAAACCCTCAACTCCGGTACCCTCACGCTCCGACCTCTCCATTTCATCAGGAGACCA
AGAATCAGGTACAACAACGTCATCAGCTAAAAAGACTAGGCAAAAGACTTTTGGATTTTTGGGTCGTGGCAAGAC
AAAATTAGAGAACAAAGAGAACGATAGTCCACGTGCGTCTCCTATGCCTCGATCAATGACACCCAACAGGCAAGA
TCCTCACCAAAATCTCTCGCCTCTTCGTACAGCCCCAGTCCTCCAAGACAACGCCTTCGACGACATGATAAACTC
GAAATCCACTCGAAACCGATCTCAAGATCGGACACCAAGCCGTGACGCCGTCTCCGTCAAGAACGGCTCCCGCGA
AAGGGATCTTCGCCACGGACCGACATCCTCTAAAGACACTAGCGCTCTAACTTTTCTCAGCGGTCTCAGAAACTC
CTCGACACGTGCTGCAGACATGATATCTAAAGGTATATTCGGAAAGGGCTCGCGAAGTAGCAATACCACAGACAA
AGAAACCATCATTGATGACGAGCATTATACCCTCAAAGTCATCACCTTGCCTCTGGTAGAACAGACTCGCTTGAC
TCGCATCTCAAAGCGGCTTGAAAAGTCGCGAGACAAGACAGAGTTTTGGATGCCCGCTTTTCCCTGGAGAGCAAT
CGACTATCTCAATTACAAGGGCTGCGACGTTGAAGGTCTCTATCGCGTTCCAGGAAGCGGTCCGCAGATCAAGAA
ATGGCAGCGAAGATTTGATGAGCGTACGTTGCATTCTGCACCAAAGCTTCGTGTTTACGTACTGATTTGTTGCCA
TAGAATACGATGTAAACTTGTTTGATGCAAAGGACTTGTACGACATCAACATTATTGGCTCAATGCTCAAGGCAT
GGCTTCGAGAGCTTCCTGACGAGCTACTACCCAAAGAGGCTCAAGACCGCATCGCGAGAGAATGTGCAGGCTCGA
TCGAGGTGCCGCAGATGCTCGTTGATGAGCTGTCAAACCTATCGCCCTTCAACTATTACCTTCTTTTTGCCATCA
CTTGCCATCTGAGTCTTCTTCTCGCGCACTCGGAGAAGAACAAGATGGATTTTCGAAACTTGTGCATATGTTTCC
AGCCATGCATGAAGATTGACGCCTTTTGCTTCAAGTTCCTCGTGTGCGACTGGAGAGACTGCTGGAAGGGCTGCA
AAAATGAAGCAAAATACATTGAGGAGGAATATACGCTATTTGAACAGCCCCTACCCCGGCGCATGTCAGAACCTC
GTCCAGCGCGGCAGACTGATAGGTACGATGAGCGCCAGCTTTCATCTCCGAGCAGCGTCGCACATTCGACCAGTG
GACAGGGCAACCGGCCAGCGCGCTCCAAGAAGCATGGCCATCAGTTATCCGACTCCAACGCGAGCGTGGGCTCAA
ACATTTCGTCGGTGTCGACCAGCCTGAGCAACAGCATCGATCGCGACACGGCTGAAGGGTCCAAAGACCTTCGTC
GCTTGTCGCCAATCAAGCCCTTATCGCCCATTGGTTTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail