Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5454
Gene name
LocationContig_50:19546..20140
Strand+
Gene length (bp)594
Transcript length (bp)594
Coding sequence length (bp)594
Protein length (aa) 198

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04939 RRS1 Ribosome biogenesis regulatory protein (RRS1) 1.5E-58 18 185

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08746|RRS1_YEAST Regulator of ribosome biosynthesis OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRS1 PE=1 SV=1 11 189 3.0E-40
sp|O59678|RRS1_SCHPO Ribosome biogenesis regulatory protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A3.16 PE=1 SV=1 13 173 5.0E-35
sp|Q9CYH6|RRS1_MOUSE Ribosome biogenesis regulatory protein homolog OS=Mus musculus GN=Rrs1 PE=1 SV=1 11 179 2.0E-29
sp|A1A5P2|RRS1_RAT Ribosome biogenesis regulatory protein homolog OS=Rattus norvegicus GN=Rrs1 PE=2 SV=1 11 179 2.0E-29
sp|Q15050|RRS1_HUMAN Ribosome biogenesis regulatory protein homolog OS=Homo sapiens GN=RRS1 PE=1 SV=2 11 149 2.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08746|RRS1_YEAST Regulator of ribosome biosynthesis OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRS1 PE=1 SV=1 11 189 3.0E-40
sp|O59678|RRS1_SCHPO Ribosome biogenesis regulatory protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A3.16 PE=1 SV=1 13 173 5.0E-35
sp|Q9CYH6|RRS1_MOUSE Ribosome biogenesis regulatory protein homolog OS=Mus musculus GN=Rrs1 PE=1 SV=1 11 179 2.0E-29
sp|A1A5P2|RRS1_RAT Ribosome biogenesis regulatory protein homolog OS=Rattus norvegicus GN=Rrs1 PE=2 SV=1 11 179 2.0E-29
sp|Q15050|RRS1_HUMAN Ribosome biogenesis regulatory protein homolog OS=Homo sapiens GN=RRS1 PE=1 SV=2 11 149 2.0E-28
sp|Q2KIH4|RRS1_BOVIN Ribosome biogenesis regulatory protein homolog OS=Bos taurus GN=RRS1 PE=2 SV=1 11 149 7.0E-27
sp|A8WY26|RRS1_CAEBR Ribosome biogenesis regulatory protein homolog OS=Caenorhabditis briggsae GN=rrbs-1 PE=3 SV=1 13 179 7.0E-19
sp|Q9XVT0|RRS1_CAEEL Ribosome biogenesis regulatory protein homolog OS=Caenorhabditis elegans GN=rrbs-1 PE=3 SV=1 13 179 4.0E-17
sp|Q9SH88|RRS1_ARATH Ribosome biogenesis regulatory protein homolog OS=Arabidopsis thaliana GN=At2g37990 PE=2 SV=2 19 192 6.0E-17
sp|Q869Q2|RRS1_DICDI Ribosome biogenesis regulatory protein homolog OS=Dictyostelium discoideum GN=rrs1 PE=3 SV=1 13 147 7.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0042254 ribosome biogenesis Yes
GO:0043229 intracellular organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0022613 ribonucleoprotein complex biogenesis No
GO:0043226 organelle No
GO:0043227 membrane-bounded organelle No
GO:0071840 cellular component organization or biogenesis No
GO:0008150 biological_process No
GO:0044085 cellular component biogenesis No
GO:0005575 cellular_component No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4600
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5454 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3010
Ophiocordyceps camponoti-floridani Ophcf2|07139
Ophiocordyceps camponoti-rufipedis Ophun1|7104
Ophiocordyceps kimflemingae Ophio5|2701
Ophiocordyceps subramaniannii Hirsu2|9655

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5454
MAIPTPPKLLVAVDKPTPYTFDLGLLVAQDPNPVTIDPATPEQSLAQLARDGAQSLINQLLTTCPLRSTTDGVIL
SLPLLSTRLPREKPVPEARPPTKWERFAEKKGIAPKTREQRRNLVYDDESGQWRRKWGYKGLNKKGENDWLVEVD
PQKEMQRKQGTTTRGDARRDRKERIKRNERKMRSNQRNAADALGKRT*
Coding >OphauG2|5454
ATGGCTATTCCTACACCGCCAAAGCTGCTCGTGGCTGTCGACAAACCGACGCCCTACACCTTCGACCTCGGCCTC
CTTGTCGCCCAGGATCCCAACCCCGTCACAATCGATCCAGCCACTCCCGAACAGTCCCTTGCACAACTTGCCCGC
GATGGCGCTCAATCCCTCATCAACCAACTATTGACCACATGCCCTTTGCGCTCCACCACGGACGGCGTGATTCTC
TCCCTACCACTCCTCTCAACACGCCTTCCGCGCGAAAAACCTGTTCCCGAAGCCCGTCCGCCGACAAAATGGGAG
CGCTTCGCCGAGAAGAAGGGCATTGCTCCCAAGACACGCGAGCAGCGTCGCAACCTGGTCTACGATGACGAGTCT
GGCCAGTGGCGACGCAAATGGGGATACAAGGGGCTGAACAAAAAGGGCGAGAACGATTGGCTAGTCGAAGTTGAT
CCGCAAAAGGAGATGCAGCGCAAGCAAGGCACAACAACCAGAGGTGACGCTCGTCGCGACCGCAAGGAAAGGATC
AAGCGCAACGAGCGCAAGATGAGGAGCAACCAGCGTAATGCTGCTGACGCCTTGGGCAAACGAACATGA
Transcript >OphauG2|5454
ATGGCTATTCCTACACCGCCAAAGCTGCTCGTGGCTGTCGACAAACCGACGCCCTACACCTTCGACCTCGGCCTC
CTTGTCGCCCAGGATCCCAACCCCGTCACAATCGATCCAGCCACTCCCGAACAGTCCCTTGCACAACTTGCCCGC
GATGGCGCTCAATCCCTCATCAACCAACTATTGACCACATGCCCTTTGCGCTCCACCACGGACGGCGTGATTCTC
TCCCTACCACTCCTCTCAACACGCCTTCCGCGCGAAAAACCTGTTCCCGAAGCCCGTCCGCCGACAAAATGGGAG
CGCTTCGCCGAGAAGAAGGGCATTGCTCCCAAGACACGCGAGCAGCGTCGCAACCTGGTCTACGATGACGAGTCT
GGCCAGTGGCGACGCAAATGGGGATACAAGGGGCTGAACAAAAAGGGCGAGAACGATTGGCTAGTCGAAGTTGAT
CCGCAAAAGGAGATGCAGCGCAAGCAAGGCACAACAACCAGAGGTGACGCTCGTCGCGACCGCAAGGAAAGGATC
AAGCGCAACGAGCGCAAGATGAGGAGCAACCAGCGTAATGCTGCTGACGCCTTGGGCAAACGAACATGA
Gene >OphauG2|5454
ATGGCTATTCCTACACCGCCAAAGCTGCTCGTGGCTGTCGACAAACCGACGCCCTACACCTTCGACCTCGGCCTC
CTTGTCGCCCAGGATCCCAACCCCGTCACAATCGATCCAGCCACTCCCGAACAGTCCCTTGCACAACTTGCCCGC
GATGGCGCTCAATCCCTCATCAACCAACTATTGACCACATGCCCTTTGCGCTCCACCACGGACGGCGTGATTCTC
TCCCTACCACTCCTCTCAACACGCCTTCCGCGCGAAAAACCTGTTCCCGAAGCCCGTCCGCCGACAAAATGGGAG
CGCTTCGCCGAGAAGAAGGGCATTGCTCCCAAGACACGCGAGCAGCGTCGCAACCTGGTCTACGATGACGAGTCT
GGCCAGTGGCGACGCAAATGGGGATACAAGGGGCTGAACAAAAAGGGCGAGAACGATTGGCTAGTCGAAGTTGAT
CCGCAAAAGGAGATGCAGCGCAAGCAAGGCACAACAACCAGAGGTGACGCTCGTCGCGACCGCAAGGAAAGGATC
AAGCGCAACGAGCGCAAGATGAGGAGCAACCAGCGTAATGCTGCTGACGCCTTGGGCAAACGAACATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail