Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5452
Gene name
LocationContig_50:14413..17158
Strand+
Gene length (bp)2745
Transcript length (bp)2592
Coding sequence length (bp)2592
Protein length (aa) 864

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00493 MCM MCM P-loop domain 3.3E-104 419 640
PF17207 MCM_OB MCM OB domain 7.4E-30 247 377
PF17855 MCM_lid MCM AAA-lid domain 3.8E-19 659 745
PF14551 MCM_N MCM N-terminal domain 4.2E-13 35 237
PF01078 Mg_chelatase Magnesium chelatase, subunit ChlI 1.4E-05 529 590
PF07728 AAA_5 AAA domain (dynein-related subfamily) 2.5E-05 475 593

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O75001|MCM7_SCHPO DNA replication licensing factor mcm7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcm7 PE=1 SV=1 99 850 0.0E+00
sp|P38132|MCM7_YEAST DNA replication licensing factor MCM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM7 PE=1 SV=4 102 860 0.0E+00
sp|P43299|MCM7_ARATH DNA replication licensing factor MCM7 OS=Arabidopsis thaliana GN=MCM7 PE=1 SV=2 102 850 0.0E+00
sp|B8BMI1|MCM7_ORYSI DNA replication licensing factor MCM7 OS=Oryza sativa subsp. indica GN=MCM7 PE=3 SV=1 102 852 0.0E+00
sp|Q2QNM1|MCM7_ORYSJ DNA replication licensing factor MCM7 OS=Oryza sativa subsp. japonica GN=MCM7 PE=2 SV=1 102 852 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O75001|MCM7_SCHPO DNA replication licensing factor mcm7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcm7 PE=1 SV=1 99 850 0.0E+00
sp|P38132|MCM7_YEAST DNA replication licensing factor MCM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM7 PE=1 SV=4 102 860 0.0E+00
sp|P43299|MCM7_ARATH DNA replication licensing factor MCM7 OS=Arabidopsis thaliana GN=MCM7 PE=1 SV=2 102 850 0.0E+00
sp|B8BMI1|MCM7_ORYSI DNA replication licensing factor MCM7 OS=Oryza sativa subsp. indica GN=MCM7 PE=3 SV=1 102 852 0.0E+00
sp|Q2QNM1|MCM7_ORYSJ DNA replication licensing factor MCM7 OS=Oryza sativa subsp. japonica GN=MCM7 PE=2 SV=1 102 852 0.0E+00
sp|P33993|MCM7_HUMAN DNA replication licensing factor MCM7 OS=Homo sapiens GN=MCM7 PE=1 SV=4 100 850 0.0E+00
sp|Q3ZBH9|MCM7_BOVIN DNA replication licensing factor MCM7 OS=Bos taurus GN=MCM7 PE=2 SV=1 100 850 0.0E+00
sp|Q61881|MCM7_MOUSE DNA replication licensing factor MCM7 OS=Mus musculus GN=Mcm7 PE=1 SV=1 100 850 0.0E+00
sp|Q9XYU0|MCM7_DROME DNA replication licensing factor Mcm7 OS=Drosophila melanogaster GN=Mcm7 PE=1 SV=1 103 850 0.0E+00
sp|Q91876|MCM7A_XENLA DNA replication licensing factor mcm7-A OS=Xenopus laevis GN=mcm7-a PE=1 SV=2 102 850 0.0E+00
sp|Q6NX31|MCM7_XENTR DNA replication licensing factor mcm7 OS=Xenopus tropicalis GN=mcm7 PE=2 SV=1 102 850 0.0E+00
sp|Q7ZXB1|MCM7B_XENLA DNA replication licensing factor mcm7-B OS=Xenopus laevis GN=mcm7-b PE=2 SV=1 102 850 0.0E+00
sp|Q0WVF5|MCM4_ARATH DNA replication licensing factor MCM4 OS=Arabidopsis thaliana GN=MCM4 PE=1 SV=1 234 742 1.0E-111
sp|Q5JKB0|MCM4_ORYSJ DNA replication licensing factor MCM4 OS=Oryza sativa subsp. japonica GN=MCM4 PE=3 SV=2 244 745 2.0E-107
sp|P53091|MCM6_YEAST DNA replication licensing factor MCM6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM6 PE=1 SV=2 247 745 5.0E-106
sp|P30665|MCM4_YEAST DNA replication licensing factor MCM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM4 PE=1 SV=2 191 742 9.0E-105
sp|P30664|MCM4B_XENLA DNA replication licensing factor mcm4-B OS=Xenopus laevis GN=mcm4-b PE=1 SV=3 244 741 2.0E-104
sp|Q5XK83|MCM4A_XENLA DNA replication licensing factor mcm4-A OS=Xenopus laevis GN=mcm4-a PE=1 SV=1 244 741 8.0E-104
sp|F4KAB8|MCM6_ARATH DNA replication licensing factor MCM6 OS=Arabidopsis thaliana GN=MCM6 PE=1 SV=1 231 745 9.0E-104
sp|P29458|MCM4_SCHPO DNA replication licensing factor mcm4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcm4 PE=1 SV=2 243 742 2.0E-103
sp|P49717|MCM4_MOUSE DNA replication licensing factor MCM4 OS=Mus musculus GN=Mcm4 PE=1 SV=1 243 741 4.0E-103
sp|Q6GL41|MCM4_XENTR DNA replication licensing factor mcm4 OS=Xenopus tropicalis GN=mcm4 PE=2 SV=1 244 788 1.0E-102
sp|P33991|MCM4_HUMAN DNA replication licensing factor MCM4 OS=Homo sapiens GN=MCM4 PE=1 SV=5 243 741 2.0E-102
sp|P49739|MCM3M_XENLA Maternal DNA replication licensing factor mcm3 OS=Xenopus laevis GN=mmcm3 PE=1 SV=2 210 742 9.0E-101
sp|Q9XYU1|MCM3_DROME DNA replication licensing factor Mcm3 OS=Drosophila melanogaster GN=Mcm3 PE=1 SV=1 248 765 3.0E-100
sp|P29496|MCM5_YEAST Minichromosome maintenance protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM5 PE=1 SV=1 324 745 4.0E-100
sp|Q26454|MCM4_DROME DNA replication licensing factor MCM4 OS=Drosophila melanogaster GN=dpa PE=1 SV=2 222 741 8.0E-100
sp|Q7Q0Q1|MCM6_ANOGA DNA replication licensing factor Mcm6 OS=Anopheles gambiae GN=Mcm6 PE=3 SV=3 247 745 2.0E-98
sp|Q7ZXZ0|MCM3Z_XENLA Zygotic DNA replication licensing factor mcm3 OS=Xenopus laevis GN=zmcm3 PE=1 SV=1 239 742 2.0E-96
sp|P25206|MCM3_MOUSE DNA replication licensing factor MCM3 OS=Mus musculus GN=Mcm3 PE=1 SV=2 239 742 2.0E-96
sp|Q28BS0|MCM3Z_XENTR Zygotic DNA replication licensing factor mcm3 OS=Xenopus tropicalis GN=zmcm3 PE=2 SV=1 237 760 3.0E-96
sp|Q9LPD9|MCM2_ARATH DNA replication licensing factor MCM2 OS=Arabidopsis thaliana GN=MCM2 PE=1 SV=1 247 742 6.0E-96
sp|Q9UXG1|MCM_SULSO Minichromosome maintenance protein MCM OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=MCM PE=1 SV=1 243 780 7.0E-96
sp|A4FUD9|MCM3_BOVIN DNA replication licensing factor MCM3 OS=Bos taurus GN=MCM3 PE=2 SV=1 239 742 7.0E-96
sp|P97311|MCM6_MOUSE DNA replication licensing factor MCM6 OS=Mus musculus GN=Mcm6 PE=1 SV=1 247 745 1.0E-95
sp|Q9V461|MCM6_DROME DNA replication licensing factor Mcm6 OS=Drosophila melanogaster GN=Mcm6 PE=1 SV=1 247 745 2.0E-95
sp|Q29JI9|MCM6_DROPS DNA replication licensing factor Mcm6 OS=Drosophila pseudoobscura pseudoobscura GN=Mcm6 PE=3 SV=1 247 745 2.0E-95
sp|Q5R8G6|MCM3_PONAB DNA replication licensing factor MCM3 OS=Pongo abelii GN=MCM3 PE=2 SV=1 239 742 2.0E-95
sp|Q5ZMN2|MCM3_CHICK DNA replication licensing factor MCM3 OS=Gallus gallus GN=MCM3 PE=2 SV=1 239 742 2.0E-95
sp|Q498J7|MC6ZA_XENLA Zygotic DNA replication licensing factor mcm6-A OS=Xenopus laevis GN=zmcm6-a PE=1 SV=1 247 745 5.0E-95
sp|P25205|MCM3_HUMAN DNA replication licensing factor MCM3 OS=Homo sapiens GN=MCM3 PE=1 SV=3 239 742 5.0E-95
sp|Q28CM3|MCM6M_XENTR Maternal DNA replication licensing factor mcm6 OS=Xenopus tropicalis GN=mmcm6 PE=2 SV=1 247 745 6.0E-95
sp|Q9FL33|MCM3_ARATH DNA replication licensing factor MCM3 OS=Arabidopsis thaliana GN=MCM3 PE=1 SV=1 242 743 1.0E-94
sp|Q14566|MCM6_HUMAN DNA replication licensing factor MCM6 OS=Homo sapiens GN=MCM6 PE=1 SV=1 247 745 1.0E-94
sp|Q7ZY18|MC6ZB_XENLA Zygotic DNA replication licensing factor mcm6-B OS=Xenopus laevis GN=zmcm6-b PE=1 SV=1 247 745 2.0E-94
sp|Q6P1V8|MCM6Z_XENTR Zygotic DNA replication licensing factor mcm6 OS=Xenopus tropicalis GN=zmcm6 PE=2 SV=1 247 745 2.0E-94
sp|Q0DHC4|MCM3_ORYSJ DNA replication licensing factor MCM3 OS=Oryza sativa subsp. japonica GN=MCM3 PE=2 SV=1 248 743 2.0E-94
sp|B8AZ99|MCM3_ORYSI DNA replication licensing factor MCM3 OS=Oryza sativa subsp. indica GN=MCM3 PE=3 SV=1 248 743 2.0E-94
sp|Q2KIZ8|MCM6_BOVIN DNA replication licensing factor MCM6 OS=Bos taurus GN=MCM6 PE=2 SV=1 247 745 3.0E-94
sp|Q6KAJ4|MCM5_ORYSJ DNA replication licensing factor MCM5 OS=Oryza sativa subsp. japonica GN=MCM5 PE=2 SV=1 239 767 5.0E-94
sp|B8AEH3|MCM5_ORYSI DNA replication licensing factor MCM5 OS=Oryza sativa subsp. indica GN=MCM5 PE=3 SV=1 239 767 6.0E-94
sp|Q5FWY4|MCM6M_XENLA Maternal DNA replication licensing factor mcm6 OS=Xenopus laevis GN=mmcm6 PE=1 SV=1 247 745 6.0E-94
sp|P49735|MCM2_DROME DNA replication licensing factor Mcm2 OS=Drosophila melanogaster GN=Mcm2 PE=1 SV=1 247 774 6.0E-94
sp|Q43704|MCM31_MAIZE DNA replication licensing factor MCM3 homolog 1 OS=Zea mays GN=ROA1 PE=2 SV=2 248 743 2.0E-93
sp|Q54CP4|MCM5_DICDI DNA replication licensing factor mcm5 OS=Dictyostelium discoideum GN=mcm5 PE=3 SV=1 210 745 2.0E-93
sp|Q9SX04|MCM32_MAIZE DNA replication licensing factor MCM3 homolog 2 OS=Zea mays GN=ROA2 PE=2 SV=1 248 743 2.0E-93
sp|Q9SX03|MCM33_MAIZE DNA replication licensing factor MCM3 homolog 3 OS=Zea mays GN=ROA3 PE=2 SV=1 248 743 2.0E-93
sp|Q9VGW6|MCM5_DROME DNA replication licensing factor Mcm5 OS=Drosophila melanogaster GN=Mcm5 PE=1 SV=1 326 745 2.0E-92
sp|P55861|MCM2_XENLA DNA replication licensing factor mcm2 OS=Xenopus laevis GN=mcm2 PE=1 SV=2 247 790 3.0E-92
sp|P97310|MCM2_MOUSE DNA replication licensing factor MCM2 OS=Mus musculus GN=Mcm2 PE=1 SV=3 247 790 5.0E-92
sp|P41389|MCM5_SCHPO DNA replication licensing factor mcm5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcm5 PE=1 SV=2 187 761 7.0E-92
sp|O80786|MCM5_ARATH DNA replication licensing factor MCM5 OS=Arabidopsis thaliana GN=MCM5 PE=1 SV=1 325 757 9.0E-92
sp|B8BKI8|MCM2_ORYSI DNA replication licensing factor MCM2 OS=Oryza sativa subsp. indica GN=OsI_36121 PE=3 SV=1 247 742 1.0E-91
sp|P49736|MCM2_HUMAN DNA replication licensing factor MCM2 OS=Homo sapiens GN=MCM2 PE=1 SV=4 247 790 2.0E-91
sp|Q2R482|MCM2_ORYSJ DNA replication licensing factor MCM2 OS=Oryza sativa subsp. japonica GN=MCM2 PE=2 SV=1 247 742 5.0E-91
sp|P49718|MCM5_MOUSE DNA replication licensing factor MCM5 OS=Mus musculus GN=Mcm5 PE=1 SV=1 188 745 7.0E-91
sp|Q6PCI7|MCM5B_XENLA DNA replication licensing factor mcm5-B OS=Xenopus laevis GN=mcm5-b PE=2 SV=1 188 756 2.0E-90
sp|Q6DIH3|MCM2_XENTR DNA replication licensing factor mcm2 OS=Xenopus tropicalis GN=mcm2 PE=2 SV=1 247 790 7.0E-90
sp|Q0V8B7|MCM5_BOVIN DNA replication licensing factor MCM5 OS=Bos taurus GN=MCM5 PE=2 SV=1 188 745 1.0E-89
sp|P40377|MCM2_SCHPO DNA replication licensing factor mcm2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcm2 PE=1 SV=1 244 768 2.0E-89
sp|P55862|MCM5A_XENLA DNA replication licensing factor mcm5-A OS=Xenopus laevis GN=mcm5-a PE=1 SV=2 188 745 4.0E-89
sp|P29469|MCM2_YEAST DNA replication licensing factor MCM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM2 PE=1 SV=2 246 770 6.0E-89
sp|P33992|MCM5_HUMAN DNA replication licensing factor MCM5 OS=Homo sapiens GN=MCM5 PE=1 SV=5 188 745 6.0E-89
sp|P30666|MCM3_SCHPO DNA replication licensing factor mcm3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcm3 PE=1 SV=2 248 742 9.0E-89
sp|Q21902|MCM5_CAEEL DNA replication licensing factor mcm-5 OS=Caenorhabditis elegans GN=mcm-5 PE=3 SV=1 246 745 2.0E-88
sp|Q561P5|MCM5_XENTR DNA replication licensing factor mcm5 OS=Xenopus tropicalis GN=mcm5 PE=2 SV=1 188 745 2.0E-88
sp|Q62724|MCM6_RAT DNA replication licensing factor MCM6 (Fragment) OS=Rattus norvegicus GN=Mcm6 PE=1 SV=2 418 745 7.0E-88
sp|Q61J08|MCM6_CAEBR DNA replication licensing factor mcm-6 OS=Caenorhabditis briggsae GN=mcm-6 PE=3 SV=1 247 745 2.0E-87
sp|P34647|MCM6_CAEEL DNA replication licensing factor mcm-6 OS=Caenorhabditis elegans GN=mcm-6 PE=1 SV=1 247 745 3.0E-86
sp|Q24849|MCM3_ENTHI DNA replication licensing factor MCM3 OS=Entamoeba histolytica GN=MCM3 PE=3 SV=1 248 742 6.0E-86
sp|P49731|MCM6_SCHPO DNA replication licensing factor mcm6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcm6 PE=1 SV=2 427 745 2.0E-84
sp|P24279|MCM3_YEAST DNA replication licensing factor MCM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM3 PE=1 SV=1 231 642 8.0E-84
sp|B8B406|MCM9_ORYSI Probable DNA helicase MCM9 OS=Oryza sativa subsp. indica GN=MCM9 PE=3 SV=1 246 745 1.0E-83
sp|Q69QA6|MCM9_ORYSJ Probable DNA helicase MCM9 OS=Oryza sativa subsp. japonica GN=MCM9 PE=2 SV=1 246 745 1.0E-83
sp|Q9SF37|MCM8_ARATH Probable DNA helicase MCM8 OS=Arabidopsis thaliana GN=MCM8 PE=2 SV=2 219 749 2.0E-83
sp|B8AZX3|MCM6_ORYSI DNA replication licensing factor MCM6 OS=Oryza sativa subsp. indica GN=MCM6 PE=3 SV=1 437 745 7.0E-82
sp|Q6F353|MCM6_ORYSJ DNA replication licensing factor MCM6 OS=Oryza sativa subsp. japonica GN=Os05g0235800 PE=3 SV=1 437 745 8.0E-82
sp|B8AZ14|MCM8_ORYSI Probable DNA helicase MCM8 OS=Oryza sativa subsp. indica GN=MCM8 PE=3 SV=1 242 749 4.0E-81
sp|B9FKM7|MCM8_ORYSJ Probable DNA helicase MCM8 OS=Oryza sativa subsp. japonica GN=MCM8 PE=2 SV=1 242 749 6.0E-81
sp|Q86B14|MCM6_DICDI DNA replication licensing factor mcm6 OS=Dictyostelium discoideum GN=mcm6 PE=3 SV=1 426 745 2.0E-80
sp|Q0V9Q6|MCM8_XENTR DNA helicase MCM8 OS=Xenopus tropicalis GN=mcm8 PE=2 SV=1 247 745 2.0E-78
sp|F4IFF3|MCM9_ARATH Probable DNA helicase MCM9 OS=Arabidopsis thaliana GN=MCM9 PE=3 SV=1 246 745 2.0E-76
sp|Q5F310|MCM8_XENLA DNA helicase MCM8 OS=Xenopus laevis GN=mcm8 PE=2 SV=2 246 745 2.0E-76
sp|I0IUP3|MCM8_CHICK DNA helicase MCM8 OS=Gallus gallus GN=MCM8 PE=1 SV=1 247 745 1.0E-75
sp|D3ZVK1|MCM8_RAT DNA helicase MCM8 OS=Rattus norvegicus GN=Mcm8 PE=3 SV=1 247 745 7.0E-75
sp|Q9CWV1|MCM8_MOUSE DNA helicase MCM8 OS=Mus musculus GN=Mcm8 PE=1 SV=3 247 745 2.0E-74
sp|Q2KHI9|MCM9_MOUSE DNA helicase MCM9 OS=Mus musculus GN=Mcm9 PE=1 SV=2 255 745 2.0E-74
sp|E1BPX4|MCM8_BOVIN DNA helicase MCM8 OS=Bos taurus GN=MCM8 PE=3 SV=2 247 745 2.0E-73
sp|Q9UJA3|MCM8_HUMAN DNA helicase MCM8 OS=Homo sapiens GN=MCM8 PE=1 SV=2 247 745 7.0E-73
sp|F1N2W9|MCM9_BOVIN DNA helicase MCM9 OS=Bos taurus GN=MCM9 PE=3 SV=2 255 745 7.0E-73
sp|F1M5F3|MCM9_RAT DNA helicase MCM9 OS=Rattus norvegicus GN=Mcm9 PE=3 SV=2 255 745 1.0E-72
sp|Q9NXL9|MCM9_HUMAN DNA helicase MCM9 OS=Homo sapiens GN=MCM9 PE=1 SV=4 255 745 1.0E-72
sp|F1QDI9|MCM9_DANRE DNA helicase MCM9 OS=Danio rerio GN=mcm9 PE=3 SV=2 255 726 3.0E-72
sp|F6RIX4|MCM9_XENTR DNA helicase MCM9 OS=Xenopus tropicalis GN=mcm9 PE=3 SV=1 251 745 3.0E-70
sp|I0IUP4|MCM9_CHICK DNA helicase MCM9 OS=Gallus gallus GN=MCM9 PE=1 SV=2 255 745 1.0E-69
sp|Q6NRM6|MCM9_XENLA DNA helicase MCM9 OS=Xenopus laevis GN=mcm9 PE=1 SV=1 251 745 2.0E-69
sp|Q58884|Y1489_METJA Uncharacterized MCM-type protein MJ1489 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1489 PE=3 SV=1 221 789 2.0E-54
sp|Q58371|Y961_METJA Uncharacterized MCM-type protein MJ0961 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0961 PE=3 SV=1 404 743 3.0E-45
sp|Q57809|Y363_METJA Uncharacterized MCM-type protein MJ0363 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0363 PE=3 SV=1 245 743 6.0E-40
sp|Q9VF30|MCMR_DROME DNA replication licensing factor REC OS=Drosophila melanogaster GN=rec PE=1 SV=2 246 640 2.0E-29
sp|Q60275|Y3513_METJA Uncharacterized MCM-type protein MJECL13 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJECL13 PE=3 SV=1 448 742 4.0E-17
sp|Q6F353|MCM6_ORYSJ DNA replication licensing factor MCM6 OS=Oryza sativa subsp. japonica GN=Os05g0235800 PE=3 SV=1 247 379 8.0E-11
sp|B8AZX3|MCM6_ORYSI DNA replication licensing factor MCM6 OS=Oryza sativa subsp. indica GN=MCM6 PE=3 SV=1 247 379 2.0E-10
sp|P49731|MCM6_SCHPO DNA replication licensing factor mcm6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcm6 PE=1 SV=2 247 379 9.0E-10
sp|Q86B14|MCM6_DICDI DNA replication licensing factor mcm6 OS=Dictyostelium discoideum GN=mcm6 PE=3 SV=1 242 379 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0005524 ATP binding Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0032508 DNA duplex unwinding Yes
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0051276 chromosome organization No
GO:0071103 DNA conformation change No
GO:0008150 biological_process No
GO:1901265 nucleoside phosphate binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016787 hydrolase activity No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0003676 nucleic acid binding No
GO:0006996 organelle organization No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0032392 DNA geometric change No
GO:0016043 cellular component organization No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0009987 cellular process No
GO:0016462 pyrophosphatase activity No
GO:0017111 nucleoside-triphosphatase activity No
GO:0071840 cellular component organization or biogenesis No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0032555 purine ribonucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4602
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5452 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3012
Ophiocordyceps camponoti-floridani Ophcf2|07137
Ophiocordyceps camponoti-rufipedis Ophun1|7102
Ophiocordyceps kimflemingae Ophio5|3997
Ophiocordyceps subramaniannii Hirsu2|9657

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5452
MALLEFKAPVNYAAQQSQSPPSTRPGYMVNKPQGAFESFLDDFKTSSEHIITTAMGDITIGDDDLSDDYDDDDCM
DQDAAPGSTRRLRRRNRQRRPKAMQHKYKDMVQEVANRTRNEIRIDLDDVDSVSQSVLGPTRQMLMPLATQWERQ
DDQGLKLVDSIERNAKHYVEILSRAVDAVMPQPSVGVSFKDDVVDVLMSRRQERNAMMEQDAAKDALVEANKFPA
ELTRRYTLVFKPRSSSSKALAVRNVRGSHIGQLITVRAIATRVSDVKPNVQVSAYTCDRCGCEIFQTVTDKQFAP
LTMCPSADCVENQSKGQLHASTRASKFLPMQEVKVQEMAEQVGIGQIPRSLTVLCHGSLVRQVNPGDIVDVSGIF
LPTPYTGFQALKAGLLTDTYLEAHDMRQHKKAYSDMTIEPRLVRRIEQYRESGQVYELLARSIAPEIYGHVDVKK
ALLLLLIGGVTKQVGDGMKIRGDINICLMGDPGVAKSQLLKYISKVAPRGVYTSGRGSSGVGLTAAVMRDPLTDE
MVLEGGALVLADNGICCIDEFDKMDENDRTAIHEVMEQQTISISKAGISTTLNARTSILAAANPIYGRYNPRISP
IDNINLPAALLSRFDVIFLLLDTPSRDSDEQLAKHVAYVHMHSQHPELGSDTVVFSPHQVRSYVAQARTYRPVVP
EAVSDYMVKTYVRLRNQQHRAEKKGQQFSHTTPRTLLGVVRLAQALARLRFSNEVTQDDMDEALRLVDASKESLN
AQTDASARRRLNASSLIYNLVKTLADTGACHAHQHAADDDDHDDHDADDDGTGVELSMPKVKERVIAKGFTEDQW
LAALEEYTNLDIWQTTGNGTRLVFVTAPFDDQDEEMSG*
Coding >OphauG2|5452
ATGGCGCTTCTCGAGTTCAAGGCTCCCGTCAACTATGCGGCGCAACAAAGTCAGTCTCCCCCCTCAACAAGACCC
GGGTACATGGTTAACAAGCCACAAGGCGCCTTTGAAAGCTTCCTCGACGACTTCAAGACATCTTCAGAGCACATA
ATCACCACTGCCATGGGCGACATCACCATTGGCGATGATGACCTAAGCGACGACTACGACGACGACGACTGCATG
GACCAAGACGCTGCGCCCGGCAGCACCCGTCGCCTGCGCCGCCGCAACCGCCAGCGGCGGCCAAAAGCGATGCAG
CACAAGTACAAGGACATGGTCCAAGAGGTAGCCAATCGCACGCGCAATGAGATTAGGATTGATCTGGATGACGTC
GACTCGGTAAGCCAGTCAGTGTTGGGCCCGACTAGGCAGATGCTGATGCCGCTGGCAACGCAGTGGGAGCGCCAA
GACGATCAAGGGCTCAAGCTCGTCGATTCGATTGAACGCAACGCCAAGCACTACGTGGAAATCTTGTCCCGGGCT
GTCGATGCTGTCATGCCCCAGCCCAGCGTGGGAGTCAGCTTCAAGGACGATGTCGTCGACGTGCTCATGTCTCGG
CGCCAGGAGCGCAACGCCATGATGGAGCAGGATGCCGCCAAGGACGCGCTGGTTGAAGCCAACAAGTTCCCGGCC
GAGCTGACGCGCCGCTACACCCTCGTCTTCAAGCCGCGCAGCAGCAGCAGCAAGGCGCTGGCAGTGCGCAACGTC
CGTGGCAGCCACATTGGCCAGCTGATTACCGTGCGAGCCATTGCCACGCGCGTCAGCGACGTCAAGCCCAATGTG
CAGGTCAGCGCCTACACATGCGACCGCTGCGGGTGCGAAATCTTCCAGACGGTGACGGACAAACAGTTTGCGCCG
CTGACCATGTGTCCGTCGGCCGACTGTGTCGAGAACCAGTCCAAGGGCCAGCTGCACGCCTCGACGCGCGCCTCC
AAGTTCCTGCCCATGCAGGAGGTCAAGGTGCAGGAGATGGCCGAGCAGGTGGGCATCGGCCAGATTCCTCGCTCC
CTGACGGTTCTGTGCCACGGCAGCCTGGTGCGCCAAGTCAATCCAGGCGACATTGTTGACGTGTCGGGCATCTTC
CTGCCCACCCCCTACACCGGCTTCCAGGCCCTCAAGGCTGGCTTGCTCACCGACACCTACCTCGAGGCCCATGAC
ATGCGCCAGCACAAAAAGGCCTACAGCGACATGACTATCGAGCCACGGCTGGTGCGCCGCATTGAGCAGTACAGA
GAATCGGGCCAGGTCTACGAGCTGCTGGCCAGGTCCATTGCGCCCGAGATCTACGGCCACGTCGACGTCAAAAAG
GCCCTGCTGCTGCTGCTCATTGGCGGCGTCACCAAGCAGGTGGGCGACGGCATGAAGATCCGCGGCGACATCAAC
ATCTGCCTCATGGGAGACCCCGGGGTGGCCAAGTCGCAGCTGCTCAAGTATATTTCAAAGGTGGCGCCCCGCGGC
GTCTACACCTCTGGCCGCGGAAGCAGCGGCGTCGGTCTCACGGCCGCCGTTATGCGCGACCCCCTGACGGATGAA
ATGGTGCTCGAGGGCGGGGCGCTCGTCCTGGCCGACAACGGCATCTGCTGCATCGACGAGTTTGACAAGATGGAC
GAAAACGACCGCACCGCCATCCACGAGGTTATGGAGCAGCAGACCATCTCCATTTCAAAGGCGGGCATCTCGACA
ACCCTTAATGCTCGCACCTCGATCCTCGCTGCCGCCAATCCCATCTATGGCCGCTACAACCCGCGCATCTCGCCC
ATTGACAACATAAACCTGCCTGCTGCTCTGCTGTCGCGCTTCGACGTCATCTTCCTGCTGCTCGACACCCCTTCT
CGCGACTCGGACGAGCAGCTCGCCAAGCACGTGGCCTATGTGCATATGCACAGCCAGCACCCCGAGCTGGGCAGC
GACACTGTCGTCTTCTCCCCACACCAAGTCCGCTCCTACGTGGCCCAGGCCCGCACCTACCGTCCCGTCGTTCCC
GAGGCCGTGTCCGACTACATGGTCAAGACATATGTTCGCCTGCGCAATCAGCAGCATCGCGCCGAGAAAAAAGGC
CAGCAGTTTTCCCACACCACCCCCCGCACTTTGCTGGGCGTCGTCCGCCTCGCCCAGGCCCTGGCGCGCTTGCGC
TTCAGCAACGAGGTGACCCAGGATGACATGGACGAGGCTCTGCGCCTTGTTGATGCCAGCAAGGAGAGCCTCAAC
GCCCAGACCGATGCCAGTGCCCGTCGACGTCTCAACGCCAGCAGCCTCATCTACAATCTCGTCAAGACTCTTGCC
GATACTGGCGCCTGTCATGCCCATCAGCATGCTGCAGACGACGACGACCACGACGACCACGACGCTGATGATGAC
GGGACTGGCGTCGAGCTAAGCATGCCCAAGGTCAAGGAGCGCGTTATTGCAAAGGGTTTCACCGAGGACCAGTGG
CTGGCCGCTCTTGAAGAGTATACCAACCTTGACATATGGCAAACCACTGGAAACGGAACAAGGCTGGTATTTGTC
ACGGCTCCTTTTGATGATCAAGATGAAGAAATGTCTGGATAG
Transcript >OphauG2|5452
ATGGCGCTTCTCGAGTTCAAGGCTCCCGTCAACTATGCGGCGCAACAAAGTCAGTCTCCCCCCTCAACAAGACCC
GGGTACATGGTTAACAAGCCACAAGGCGCCTTTGAAAGCTTCCTCGACGACTTCAAGACATCTTCAGAGCACATA
ATCACCACTGCCATGGGCGACATCACCATTGGCGATGATGACCTAAGCGACGACTACGACGACGACGACTGCATG
GACCAAGACGCTGCGCCCGGCAGCACCCGTCGCCTGCGCCGCCGCAACCGCCAGCGGCGGCCAAAAGCGATGCAG
CACAAGTACAAGGACATGGTCCAAGAGGTAGCCAATCGCACGCGCAATGAGATTAGGATTGATCTGGATGACGTC
GACTCGGTAAGCCAGTCAGTGTTGGGCCCGACTAGGCAGATGCTGATGCCGCTGGCAACGCAGTGGGAGCGCCAA
GACGATCAAGGGCTCAAGCTCGTCGATTCGATTGAACGCAACGCCAAGCACTACGTGGAAATCTTGTCCCGGGCT
GTCGATGCTGTCATGCCCCAGCCCAGCGTGGGAGTCAGCTTCAAGGACGATGTCGTCGACGTGCTCATGTCTCGG
CGCCAGGAGCGCAACGCCATGATGGAGCAGGATGCCGCCAAGGACGCGCTGGTTGAAGCCAACAAGTTCCCGGCC
GAGCTGACGCGCCGCTACACCCTCGTCTTCAAGCCGCGCAGCAGCAGCAGCAAGGCGCTGGCAGTGCGCAACGTC
CGTGGCAGCCACATTGGCCAGCTGATTACCGTGCGAGCCATTGCCACGCGCGTCAGCGACGTCAAGCCCAATGTG
CAGGTCAGCGCCTACACATGCGACCGCTGCGGGTGCGAAATCTTCCAGACGGTGACGGACAAACAGTTTGCGCCG
CTGACCATGTGTCCGTCGGCCGACTGTGTCGAGAACCAGTCCAAGGGCCAGCTGCACGCCTCGACGCGCGCCTCC
AAGTTCCTGCCCATGCAGGAGGTCAAGGTGCAGGAGATGGCCGAGCAGGTGGGCATCGGCCAGATTCCTCGCTCC
CTGACGGTTCTGTGCCACGGCAGCCTGGTGCGCCAAGTCAATCCAGGCGACATTGTTGACGTGTCGGGCATCTTC
CTGCCCACCCCCTACACCGGCTTCCAGGCCCTCAAGGCTGGCTTGCTCACCGACACCTACCTCGAGGCCCATGAC
ATGCGCCAGCACAAAAAGGCCTACAGCGACATGACTATCGAGCCACGGCTGGTGCGCCGCATTGAGCAGTACAGA
GAATCGGGCCAGGTCTACGAGCTGCTGGCCAGGTCCATTGCGCCCGAGATCTACGGCCACGTCGACGTCAAAAAG
GCCCTGCTGCTGCTGCTCATTGGCGGCGTCACCAAGCAGGTGGGCGACGGCATGAAGATCCGCGGCGACATCAAC
ATCTGCCTCATGGGAGACCCCGGGGTGGCCAAGTCGCAGCTGCTCAAGTATATTTCAAAGGTGGCGCCCCGCGGC
GTCTACACCTCTGGCCGCGGAAGCAGCGGCGTCGGTCTCACGGCCGCCGTTATGCGCGACCCCCTGACGGATGAA
ATGGTGCTCGAGGGCGGGGCGCTCGTCCTGGCCGACAACGGCATCTGCTGCATCGACGAGTTTGACAAGATGGAC
GAAAACGACCGCACCGCCATCCACGAGGTTATGGAGCAGCAGACCATCTCCATTTCAAAGGCGGGCATCTCGACA
ACCCTTAATGCTCGCACCTCGATCCTCGCTGCCGCCAATCCCATCTATGGCCGCTACAACCCGCGCATCTCGCCC
ATTGACAACATAAACCTGCCTGCTGCTCTGCTGTCGCGCTTCGACGTCATCTTCCTGCTGCTCGACACCCCTTCT
CGCGACTCGGACGAGCAGCTCGCCAAGCACGTGGCCTATGTGCATATGCACAGCCAGCACCCCGAGCTGGGCAGC
GACACTGTCGTCTTCTCCCCACACCAAGTCCGCTCCTACGTGGCCCAGGCCCGCACCTACCGTCCCGTCGTTCCC
GAGGCCGTGTCCGACTACATGGTCAAGACATATGTTCGCCTGCGCAATCAGCAGCATCGCGCCGAGAAAAAAGGC
CAGCAGTTTTCCCACACCACCCCCCGCACTTTGCTGGGCGTCGTCCGCCTCGCCCAGGCCCTGGCGCGCTTGCGC
TTCAGCAACGAGGTGACCCAGGATGACATGGACGAGGCTCTGCGCCTTGTTGATGCCAGCAAGGAGAGCCTCAAC
GCCCAGACCGATGCCAGTGCCCGTCGACGTCTCAACGCCAGCAGCCTCATCTACAATCTCGTCAAGACTCTTGCC
GATACTGGCGCCTGTCATGCCCATCAGCATGCTGCAGACGACGACGACCACGACGACCACGACGCTGATGATGAC
GGGACTGGCGTCGAGCTAAGCATGCCCAAGGTCAAGGAGCGCGTTATTGCAAAGGGTTTCACCGAGGACCAGTGG
CTGGCCGCTCTTGAAGAGTATACCAACCTTGACATATGGCAAACCACTGGAAACGGAACAAGGCTGGTATTTGTC
ACGGCTCCTTTTGATGATCAAGATGAAGAAATGTCTGGATAG
Gene >OphauG2|5452
ATGGCGCTTCTCGAGTTCAAGGCTCCCGTCAACTATGCGGCGCAACAAAGTCAGTCTCCCCCCTCAACAAGACCC
GGGTACATGGTTAACAAGCCACAAGGCGCCTTTGAAAGCTTCCTCGACGACTTCAAGACATCTTCAGAGCACATA
ATCACCACTGCCATGGGCGACATCACCATTGGCGATGATGACCTAAGCGACGACTACGACGACGACGACTGCATG
GACCAAGACGCTGCGCCCGGCAGCACCCGTCGCCTGCGCCGCCGCAACCGCCAGCGGCGGCCAAAAGCGATGCAG
CACAAGTACAAGGACATGGTCCAAGAGGTAGCCAATCGCACGCGCAATGAGATTAGGATTGATCTGGATGACGTC
GACTCGGTAAGCCAGTCAGTGTTGGGCCCGACTAGGCAGATGCTGATGCCGCTGGCAACGCAGTGGGAGCGCCAA
GACGATCAAGGGCTCAAGCTCGTCGATTCGATTGAACGCAACGCCAAGCACTACGTGGAAATCTTGTCCCGGGCT
GTCGATGCTGTCATGCCCCAGCCCAGCGTGGGAGTCAGGTAAGTCGTCCTCTTGTCCTTGCCTTGCGGCGACTGG
GCTGCATCTGTGGCCTGGCTCTGACACAGCAGCTGTCTGCAGCTTCAAGGACGATGTCGTCGACGTGCTCATGTC
TCGGCGCCAGGAGCGCAACGCCATGATGGAGCAGGATGCCGCCAAGGACGCGCTGGTTGAAGCCAACAAGTTCCC
GGCCGAGCTGACGCGCCGCTACACCCTCGTCTTCAAGCCGCGCAGCAGCAGCAGCAAGGCGCTGGCAGTGCGCAA
CGTCCGTGGCAGCCACATTGGCCAGCTGATTACCGTGCGAGCCATTGCCACGCGCGTCAGCGACGTCAAGCCCAA
TGTGCAGGTCAGCGCCTACACATGCGACCGCTGCGGGTGCGAAATCTTCCAGACGGTGACGGACAAACAGTTTGC
GCCGCTGACCATGTGTCCGTCGGCCGACTGTGTCGAGAACCAGTCCAAGGGCCAGCTGCACGCCTCGACGCGCGC
CTCCAAGTTCCTGCCCATGCAGGAGGTCAAGGTGCAGGAGATGGCCGAGCAGGTGGGCATCGGCCAGATTCCTCG
CTCCCTGACGGTTCTGTGCCACGGCAGCCTGGTGCGCCAAGTCAATCCAGGCGACATTGTTGACGTGTCGGGCAT
CTTCCTGCCCACCCCCTACACCGGCTTCCAGGCCCTCAAGGCTGGCTTGCTCACCGACACCTACCTCGAGGCCCA
TGACATGCGCCAGCACAAAAAGGCCTACAGCGACATGACTATCGAGCCACGGCTGGTGCGCCGCATTGAGCAGTA
CAGAGAATCGGGCCAGGTCTACGAGCTGCTGGCCAGGTCCATTGCGCCCGAGATCTACGGCCACGTCGACGTCAA
AAAGGCCCTGCTGCTGCTGCTCATTGGCGGCGTCACCAAGCAGGTGGGCGACGGCATGAAGATCCGCGGCGACAT
CAACATCTGCCTCATGGGAGACCCCGGGGTGGCCAAGTCGCAGCTGCTCAAGTATATTTCAAAGGTGGCGCCCCG
CGGCGTCTACACCTCTGGCCGCGGAAGCAGCGGCGTCGGTCTCACGGCCGCCGTTATGCGCGACCCCCTGACGGA
TGAAATGGTGCTCGAGGGCGGGGCGCTCGTCCTGGCCGACAACGGCATCTGCTGCATCGACGAGTTTGACAAGAT
GGACGAAAACGACCGCACCGCCATCCACGAGGTTATGGAGCAGCAGACCATCTCCATTTCAAAGGCGGGCATCTC
GACAACCCTTAATGCTCGCACCTCGATCCTCGCTGCCGCCAATCCCATCTATGGCCGCTACAACCCGCGCATCTC
GCCCATTGACAACATAAACCTGCCTGCTGCTCTGCTGTCGCGCTTCGACGTCATCTTCCTGCTGCTCGACACCCC
TTCTCGCGACTCGGACGAGCAGCTCGCCAAGCACGTGGCCTATGTGCATATGCACAGCCAGCACCCCGAGCTGGG
CAGCGACACTGTCGTCTTCTCCCCACACCAAGTCCGCTCCTACGTGGCCCAGGCCCGCACCTACCGTCCCGTCGT
TCCCGAGGCCGTGTCCGACTACATGGTCAAGACATATGTTCGCCTGCGCAATCAGCAGCATCGCGCCGAGAAAAA
AGGCCAGCAGTTTTCCCACACCACCCCCCGCACTTTGCTGGGCGTCGTCCGCCTCGCCCAGGCCCTGGCGCGCTT
GCGCTTCAGCAACGAGGTGACCCAGGATGACATGGACGAGGCTCTGCGCCTTGTTGATGCCAGCAAGGAGAGCCT
CAACGCCCAGACCGATGCCAGTGCCCGTCGACGTCTCAACGCCAGCAGCCTCATCTACAATCTCGTCAAGACTCT
TGCCGATACTGGCGCCTGTCATGCCCATCAGCATGCTGCAGACGACGACGACCACGACGACCACGACGCTGATGA
TGACGGGACTGGCGTCGAGCTAAGCATGCCCAAGGTCAAGGAGCGCGTTATTGCAAAGGGTTTCACCGAGGACCA
GTGGCTGGCCGCTCTTGAAGAGTATACCAACCTTGACGTCAGTCTCTCACCCCTCTCTGCTCCCCGTGTGCAAGC
TACATATGTATATGCTGACAATATTTGCTATGCTAGATATGGCAAACCACTGGAAACGGAACAAGGCTGGTATTT
GTCACGGCTCCTTTTGATGATCAAGATGAAGAAATGTCTGGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail