Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5447
Gene name
LocationContig_50:3946..5201
Strand-
Gene length (bp)1255
Transcript length (bp)1122
Coding sequence length (bp)1122
Protein length (aa) 374

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17683 TFIIF_beta_N TFIIF, beta subunit N-terminus 7.3E-30 40 207
PF02270 TFIIF_beta TFIIF, beta subunit HTH domain 7.1E-28 277 341

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P41896|T2FB_YEAST Transcription initiation factor IIF subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFG2 PE=1 SV=2 36 371 2.0E-29
sp|O94424|T2FB_SCHPO Transcription initiation factor IIF subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfg2 PE=1 SV=1 191 341 4.0E-24
sp|Q03123|T2FB_XENLA General transcription factor IIF subunit 2 OS=Xenopus laevis GN=gtf2f2 PE=2 SV=1 264 347 6.0E-08
sp|Q54KT7|T2FB_DICDI General transcription factor IIF subunit 2 OS=Dictyostelium discoideum GN=gtf2f2 PE=3 SV=2 279 346 8.0E-08
sp|Q2T9L9|T2FB_BOVIN General transcription factor IIF subunit 2 OS=Bos taurus GN=GTF2F2 PE=2 SV=1 269 341 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P41896|T2FB_YEAST Transcription initiation factor IIF subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFG2 PE=1 SV=2 36 371 2.0E-29
sp|O94424|T2FB_SCHPO Transcription initiation factor IIF subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfg2 PE=1 SV=1 191 341 4.0E-24
sp|Q03123|T2FB_XENLA General transcription factor IIF subunit 2 OS=Xenopus laevis GN=gtf2f2 PE=2 SV=1 264 347 6.0E-08
sp|Q54KT7|T2FB_DICDI General transcription factor IIF subunit 2 OS=Dictyostelium discoideum GN=gtf2f2 PE=3 SV=2 279 346 8.0E-08
sp|Q2T9L9|T2FB_BOVIN General transcription factor IIF subunit 2 OS=Bos taurus GN=GTF2F2 PE=2 SV=1 269 341 2.0E-06
sp|P13984|T2FB_HUMAN General transcription factor IIF subunit 2 OS=Homo sapiens GN=GTF2F2 PE=1 SV=2 269 347 2.0E-06
sp|Q01750|T2FB_RAT General transcription factor IIF subunit 2 OS=Rattus norvegicus GN=Gtf2f2 PE=1 SV=1 269 341 3.0E-06
sp|Q8R0A0|T2FB_MOUSE General transcription factor IIF subunit 2 OS=Mus musculus GN=Gtf2f2 PE=1 SV=1 269 341 3.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4610
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5447 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3018
Ophiocordyceps camponoti-floridani Ophcf2|07329
Ophiocordyceps camponoti-rufipedis Ophun1|7549
Ophiocordyceps kimflemingae Ophio5|8371
Ophiocordyceps subramaniannii Hirsu2|9670

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5447
MVKTDPEDKKPLLNMDDFADEDAGDLEFYDKASATRQFETLYLARIPRSMWKAWMQLVDRLGDDDEIQIGTLRTW
NEPVADASVEGGSRDVTRLRMLLHDKCPEHQLLPREYDLEVLDREVQNHYIFSEQDLPSYKAKNKARAEAASAGI
PASLLRQQAQQTGGASEQGPQRPAYDRRNRYQPYYRKAIPKRTKIFGKIHYDVRVEPRNAQEEEHLLAQRLFDAE
HAKSTLKVISHNTAAEMMMNAGAGTAAQWSDSFIKNAPLQTKAKKGEVFKAARIPKNQLLDLIFDCFRQYQYWSM
KALRQRLQQPDSYLRQVLEEVAVLHKSGRFANHYGLSDAYKDKAGSDAKEEAAEAADEGDDDDGEEMEDVLPA*
Coding >OphauG2|5447
ATGGTCAAGACGGATCCCGAAGACAAGAAACCCTTGTTGAACATGGACGACTTCGCCGATGAGGATGCAGGCGAC
CTCGAGTTCTACGACAAGGCCTCGGCCACCCGCCAGTTCGAAACACTTTACCTGGCGCGCATTCCACGGTCCATG
TGGAAGGCGTGGATGCAGCTGGTGGACAGGCTGGGCGATGACGACGAGATACAGATTGGCACGCTGCGCACTTGG
AACGAGCCTGTCGCTGACGCATCGGTTGAAGGCGGCTCACGCGACGTGACAAGACTGCGGATGCTGCTCCATGAC
AAGTGTCCAGAGCACCAACTGCTCCCACGCGAATATGACCTCGAGGTTCTCGACCGTGAGGTCCAGAACCACTAC
ATATTTAGTGAGCAAGATCTGCCCAGCTACAAGGCCAAGAACAAAGCTCGTGCCGAGGCTGCAAGCGCAGGCATT
CCTGCCTCGCTCCTCCGACAACAAGCACAACAAACCGGGGGCGCTTCAGAGCAGGGCCCGCAAAGACCTGCGTAT
GACCGGAGAAATCGTTATCAGCCTTATTACCGCAAGGCCATTCCAAAAAGAACAAAGATCTTTGGCAAGATTCAC
TACGATGTCCGGGTTGAGCCACGCAACGCACAGGAGGAAGAGCATCTTCTCGCGCAGCGCCTCTTCGATGCCGAG
CACGCCAAGTCGACACTCAAAGTCATCAGCCACAACACAGCAGCCGAAATGATGATGAATGCCGGTGCTGGCACA
GCCGCTCAATGGAGTGACAGCTTCATTAAAAATGCCCCACTACAGACCAAAGCCAAAAAGGGCGAGGTTTTCAAG
GCTGCCCGTATTCCCAAGAATCAGCTTCTTGACCTCATTTTTGACTGTTTCCGCCAATACCAGTACTGGTCCATG
AAGGCGCTTAGACAGAGGCTACAACAGCCCGACTCTTATTTGCGGCAAGTCCTCGAAGAGGTTGCGGTTCTACAC
AAGAGTGGGAGGTTTGCCAATCACTATGGCTTGAGTGATGCCTACAAGGATAAGGCGGGCAGCGATGCCAAGGAA
GAGGCGGCTGAGGCTGCTGACGAGGGAGACGACGATGACGGAGAGGAAATGGAGGATGTTTTGCCCGCATAG
Transcript >OphauG2|5447
ATGGTCAAGACGGATCCCGAAGACAAGAAACCCTTGTTGAACATGGACGACTTCGCCGATGAGGATGCAGGCGAC
CTCGAGTTCTACGACAAGGCCTCGGCCACCCGCCAGTTCGAAACACTTTACCTGGCGCGCATTCCACGGTCCATG
TGGAAGGCGTGGATGCAGCTGGTGGACAGGCTGGGCGATGACGACGAGATACAGATTGGCACGCTGCGCACTTGG
AACGAGCCTGTCGCTGACGCATCGGTTGAAGGCGGCTCACGCGACGTGACAAGACTGCGGATGCTGCTCCATGAC
AAGTGTCCAGAGCACCAACTGCTCCCACGCGAATATGACCTCGAGGTTCTCGACCGTGAGGTCCAGAACCACTAC
ATATTTAGTGAGCAAGATCTGCCCAGCTACAAGGCCAAGAACAAAGCTCGTGCCGAGGCTGCAAGCGCAGGCATT
CCTGCCTCGCTCCTCCGACAACAAGCACAACAAACCGGGGGCGCTTCAGAGCAGGGCCCGCAAAGACCTGCGTAT
GACCGGAGAAATCGTTATCAGCCTTATTACCGCAAGGCCATTCCAAAAAGAACAAAGATCTTTGGCAAGATTCAC
TACGATGTCCGGGTTGAGCCACGCAACGCACAGGAGGAAGAGCATCTTCTCGCGCAGCGCCTCTTCGATGCCGAG
CACGCCAAGTCGACACTCAAAGTCATCAGCCACAACACAGCAGCCGAAATGATGATGAATGCCGGTGCTGGCACA
GCCGCTCAATGGAGTGACAGCTTCATTAAAAATGCCCCACTACAGACCAAAGCCAAAAAGGGCGAGGTTTTCAAG
GCTGCCCGTATTCCCAAGAATCAGCTTCTTGACCTCATTTTTGACTGTTTCCGCCAATACCAGTACTGGTCCATG
AAGGCGCTTAGACAGAGGCTACAACAGCCCGACTCTTATTTGCGGCAAGTCCTCGAAGAGGTTGCGGTTCTACAC
AAGAGTGGGAGGTTTGCCAATCACTATGGCTTGAGTGATGCCTACAAGGATAAGGCGGGCAGCGATGCCAAGGAA
GAGGCGGCTGAGGCTGCTGACGAGGGAGACGACGATGACGGAGAGGAAATGGAGGATGTTTTGCCCGCATAG
Gene >OphauG2|5447
ATGGTCAAGACGGATCCCGAAGACAAGAAACCCTTGTTGAACATGGACGACTTCGCCGATGAGGATGCAGGCGAC
CTCGAGTTCTACGACAAGGCCTCGGCCACCCGCCAGTTCGAAACACTTTACCTGGCGCGCATTCCACGGTCCATG
TGGAAGGCGTGGATGCAGCTGGTGGACAGGCTGGGCGATGACGACGAGATACAGATTGGCACGCTGCGCACTTGG
AACGAGCCTGTCGCTGACGCATCGGTTGAAGGCGGCTCACGCGACGTGACAAGACTGCGGATGCTGCTCCATGAC
AAGTGTCCAGAGCACCAACTGCTCCCACGCGAATATGACCTCGAGGTTCTCGACCGTGAGGTCCAGAACCACTAC
ATATTTAGTGAGCAAGATCTGCCCAGCTACAAGGCCAAGAACAAAGCTCGTGCCGAGGCTGCAAGCGCAGGCATT
CCTGCCTCGCTCCTCCGACAACAAGCACAACAAACCGGGGGCGCTTCAGAGCAGGGCCCGCAAAGACCTGCGTAT
GACCGGAGAAATCGTTATCAGCCTTATTACCGCAAGGCCATTCCAAGTAAGTGTGGCCTTGACATGAACAGTCGG
GCTCCATTCTAAATGGCTTGTCCCTTTCAGAAAGAACAAAGATCTTTGGCAAGATTCACTACGATGTCCGGGTTG
AGCCACGCAACGCACAGGAGGAAGAGCATCTTCTCGCGCAGCGCCTCTTCGATGCCGAGCACGCCAAGTCGACAC
TCAAAGTCATCAGCCACAACACAGCAGCCGAAATGATGATGAATGCCGGTGCTGGCACAGCCGCTCAATGGAGTG
ACAGCTTCATTGTTAGTTGCCCGTTTGGCACGCGATGCGCCGTGGCCATTGATATTAATATACGGCACGCTGACT
ACTATACCAGAAAAATGCCCCACTACAGACCAAAGCCAAAAAGGGCGAGGTTTTCAAGGCTGCCCGTATTCCCAA
GAATCAGCTTCTTGACCTCATTTTTGACTGTTTCCGCCAATACCAGTACTGGTCCATGAAGGCGCTTAGACAGAG
GCTACAACAGCCCGACTCTTATTTGCGGCAAGTCCTCGAAGAGGTTGCGGTTCTACACAAGAGTGGGAGGTTTGC
CAATCACTATGGCTTGAGTGATGCCTACAAGGATAAGGCGGGCAGCGATGCCAAGGAAGAGGCGGCTGAGGCTGC
TGACGAGGGAGACGACGATGACGGAGAGGAAATGGAGGATGTTTTGCCCGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail