Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5431
Gene name
LocationContig_5:47443..48016
Strand+
Gene length (bp)573
Transcript length (bp)573
Coding sequence length (bp)573
Protein length (aa) 191

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08265 YL1_C YL1 nuclear protein C-terminal domain 1.9E-14 140 168

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UTE8|IES6_SCHPO Chromatin-remodeling complex subunit ies6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ies6 PE=3 SV=1 124 190 2.0E-19
sp|P32617|IES6_YEAST Chromatin-remodeling complex subunit IES6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IES6 PE=1 SV=1 120 190 9.0E-14
sp|Q5BJY3|IN80C_RAT INO80 complex subunit C OS=Rattus norvegicus GN=Ino80c PE=2 SV=1 125 189 6.0E-10
sp|Q8BHA0|IN80C_MOUSE INO80 complex subunit C OS=Mus musculus GN=Ino80c PE=1 SV=1 125 189 9.0E-10
sp|Q6PI98|IN80C_HUMAN INO80 complex subunit C OS=Homo sapiens GN=INO80C PE=1 SV=1 125 189 1.0E-09

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3642
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5431 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3892
Ophiocordyceps camponoti-floridani Ophcf2|04115
Ophiocordyceps camponoti-rufipedis Ophun1|6666
Ophiocordyceps kimflemingae Ophio5|8413
Ophiocordyceps subramaniannii Hirsu2|7026

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5431
MAAPTEAQIAHQQLVEKLDMHALHKNFRNPNWRPNQRRNKNLKTIVGDASKKELSAMATPQDGSGNATPADDALS
TSGTSTPTNGNSNSTPNLAQASRSLSKLVLEKSLSKMPGGAAVAAPSATYTNIESAPSLAHAKRYCDVTGLPAPY
LDPKTRMRYHNTEVFGLIRSLPQTSAEQYLEARGAHTVLK*
Coding >OphauG2|5431
ATGGCCGCTCCCACAGAAGCCCAGATCGCCCACCAGCAACTCGTCGAGAAACTCGACATGCACGCCTTGCACAAA
AACTTTCGCAACCCAAACTGGCGGCCCAACCAGCGCCGCAACAAGAATCTCAAGACTATTGTCGGCGATGCGTCC
AAAAAGGAGCTCTCTGCCATGGCTACTCCGCAAGACGGCAGCGGCAACGCCACGCCCGCTGATGACGCCCTTTCA
ACCAGTGGCACCTCAACGCCCACCAATGGAAACTCGAATAGCACACCCAATCTCGCCCAGGCCTCGCGCAGCCTG
TCCAAGCTGGTCTTGGAAAAAAGCCTTAGCAAGATGCCCGGGGGGGCTGCCGTTGCTGCACCAAGTGCTACTTAT
ACAAATATCGAGTCGGCACCTTCGCTCGCACACGCAAAACGCTACTGCGATGTCACCGGCCTGCCGGCCCCCTAT
CTCGACCCCAAGACCCGAATGCGCTATCACAATACCGAAGTATTTGGTTTAATACGGTCGCTTCCACAAACATCG
GCCGAGCAGTATCTCGAGGCTCGTGGTGCCCACACAGTTCTCAAGTAA
Transcript >OphauG2|5431
ATGGCCGCTCCCACAGAAGCCCAGATCGCCCACCAGCAACTCGTCGAGAAACTCGACATGCACGCCTTGCACAAA
AACTTTCGCAACCCAAACTGGCGGCCCAACCAGCGCCGCAACAAGAATCTCAAGACTATTGTCGGCGATGCGTCC
AAAAAGGAGCTCTCTGCCATGGCTACTCCGCAAGACGGCAGCGGCAACGCCACGCCCGCTGATGACGCCCTTTCA
ACCAGTGGCACCTCAACGCCCACCAATGGAAACTCGAATAGCACACCCAATCTCGCCCAGGCCTCGCGCAGCCTG
TCCAAGCTGGTCTTGGAAAAAAGCCTTAGCAAGATGCCCGGGGGGGCTGCCGTTGCTGCACCAAGTGCTACTTAT
ACAAATATCGAGTCGGCACCTTCGCTCGCACACGCAAAACGCTACTGCGATGTCACCGGCCTGCCGGCCCCCTAT
CTCGACCCCAAGACCCGAATGCGCTATCACAATACCGAAGTATTTGGTTTAATACGGTCGCTTCCACAAACATCG
GCCGAGCAGTATCTCGAGGCTCGTGGTGCCCACACAGTTCTCAAGTAA
Gene >OphauG2|5431
ATGGCCGCTCCCACAGAAGCCCAGATCGCCCACCAGCAACTCGTCGAGAAACTCGACATGCACGCCTTGCACAAA
AACTTTCGCAACCCAAACTGGCGGCCCAACCAGCGCCGCAACAAGAATCTCAAGACTATTGTCGGCGATGCGTCC
AAAAAGGAGCTCTCTGCCATGGCTACTCCGCAAGACGGCAGCGGCAACGCCACGCCCGCTGATGACGCCCTTTCA
ACCAGTGGCACCTCAACGCCCACCAATGGAAACTCGAATAGCACACCCAATCTCGCCCAGGCCTCGCGCAGCCTG
TCCAAGCTGGTCTTGGAAAAAAGCCTTAGCAAGATGCCCGGGGGGGCTGCCGTTGCTGCACCAAGTGCTACTTAT
ACAAATATCGAGTCGGCACCTTCGCTCGCACACGCAAAACGCTACTGCGATGTCACCGGCCTGCCGGCCCCCTAT
CTCGACCCCAAGACCCGAATGCGCTATCACAATACCGAAGTATTTGGTTTAATACGGTCGCTTCCACAAACATCG
GCCGAGCAGTATCTCGAGGCTCGTGGTGCCCACACAGTTCTCAAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail