Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|543
Gene name
LocationContig_1128:2861..5452
Strand-
Gene length (bp)2591
Transcript length (bp)2097
Coding sequence length (bp)2097
Protein length (aa) 699

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12896 ANAPC4 Anaphase-promoting complex, cyclosome, subunit 4 1.0E-56 271 472
PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain 1.1E-05 29 99

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O42839|APC4_SCHPO Anaphase-promoting complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut20 PE=1 SV=2 70 507 3.0E-10
sp|Q5RAQ5|APC4_PONAB Anaphase-promoting complex subunit 4 OS=Pongo abelii GN=ANAPC4 PE=2 SV=1 184 512 3.0E-09
sp|Q9UJX5|APC4_HUMAN Anaphase-promoting complex subunit 4 OS=Homo sapiens GN=ANAPC4 PE=1 SV=2 184 512 6.0E-09
sp|Q91W96|APC4_MOUSE Anaphase-promoting complex subunit 4 OS=Mus musculus GN=Anapc4 PE=1 SV=1 205 512 6.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|543
MANAAPCELALMSEMRLDYKLPAGYPVACPTVDLAAVPDTDGKALLVKRPPNFDVLKSHGPFRPGQLQAEVVAVT
WQKDGQQVVVGWSNGSVRLVALDNPTPSYHAELCCTPPGTKITRIGCAVKLVSTRTLDLPHDHGRRQPSRLPPGW
IKDRLYVDFEPVLPKLSPFPTSSAGPDELATLFTQRVVSDLVSSDTSSTEAHDSLNLMVVGTDDGKVQLVLHHSL
VIGIFDCSVQTPLATPRLLDYASNPLLSTQLLLFADTAHEPEDVWMVPMDLPFLMPTDFSLSHLCHMLANLTNIF
RYLKQASLHLGVEWKNATELPKRFLQSAQATLREAKNGPQDVTTALYHLALSGHAHTQLREWLVDTVGERGHKRW
EKAVDTALKNMRTLVHENLIPATDRCVIVLSRLHGFSQAYTDSDHLDFTPAQVSKITNIVNGLAIVSHEILQDVM
DQLEYFATFSDWLYFHIDRLTSGTTEDLTDKEAALNSSNVITFVQDYLTASPLDVYFNDVTDEDAAMARLECDKL
PNFLDLLDTQLQKQIEGRPYLKALPNIHFVIDHAISMYSDLVDTIADGKRRSVRFGSAVKLSVGHPISSINLAMC
PTAQESPFMCAALTSNHAKDKVFFFRSTIEIVSGISTTQPVTACCIHVGSVQVLDAQFIDGRILVLTCSDLDNRT
IVIPVSHDQNSLTTQLPDVYAPQ*
Coding >OphauG2|543
ATGGCCAATGCTGCGCCGTGCGAGCTCGCCTTGATGAGCGAGATGCGTCTCGACTATAAGCTCCCTGCCGGCTAC
CCTGTGGCGTGTCCTACAGTCGACTTGGCGGCGGTGCCCGACACCGACGGCAAAGCGCTGCTCGTCAAGCGCCCG
CCTAATTTTGATGTGCTCAAGAGCCACGGGCCGTTTCGGCCGGGGCAACTGCAGGCAGAAGTGGTGGCTGTGACG
TGGCAGAAAGACGGCCAACAAGTCGTAGTCGGCTGGAGCAATGGCTCGGTGCGTCTCGTGGCCCTCGACAACCCG
ACGCCCTCATACCACGCCGAGCTGTGCTGCACACCGCCTGGCACCAAAATCACTCGCATTGGCTGCGCCGTCAAA
CTTGTGTCTACTAGAACACTCGACTTGCCACACGACCATGGACGCCGTCAGCCAAGCCGCCTGCCCCCGGGGTGG
ATCAAGGACAGGCTCTACGTCGACTTTGAGCCCGTGTTGCCCAAGCTCAGTCCCTTTCCCACCAGCAGCGCCGGT
CCAGACGAGCTGGCCACTCTATTCACCCAGCGCGTTGTTTCCGACCTTGTCTCTTCAGACACGTCGAGTACAGAG
GCGCACGACAGCCTCAACTTAATGGTAGTGGGCACTGATGATGGCAAGGTGCAGCTCGTTTTGCATCATTCCCTC
GTTATTGGCATCTTCGACTGTTCAGTGCAGACGCCGTTGGCCACGCCCCGGCTGCTCGACTACGCGTCCAATCCC
CTGCTCTCCACCCAGCTTCTCCTCTTCGCCGACACGGCCCATGAGCCAGAAGACGTCTGGATGGTGCCAATGGAC
CTGCCCTTCCTCATGCCTACCGACTTTAGTCTGTCACACCTGTGCCATATGCTCGCCAACTTGACAAATATTTTC
CGCTATCTCAAGCAGGCTAGCTTGCACCTGGGTGTCGAATGGAAAAACGCCACGGAGCTGCCCAAACGCTTCCTG
CAAAGTGCCCAAGCCACCTTGCGGGAAGCCAAGAATGGGCCTCAAGACGTGACGACAGCCCTCTACCACTTGGCC
CTCAGCGGCCACGCCCACACGCAGTTGCGCGAATGGCTCGTTGACACTGTGGGCGAGCGTGGCCACAAGCGCTGG
GAGAAAGCTGTTGACACGGCCCTCAAGAACATGCGCACTCTTGTCCACGAGAACCTCATTCCTGCAACGGATCGC
TGCGTCATCGTGCTCAGCAGGCTGCATGGCTTTTCCCAGGCTTATACCGACAGCGACCACCTTGACTTTACTCCA
GCCCAAGTCAGCAAAATCACAAACATCGTTAACGGCCTGGCCATTGTCAGCCACGAGATTCTCCAGGATGTCATG
GATCAACTTGAATATTTTGCCACCTTTTCTGATTGGCTCTATTTCCACATTGACCGCTTGACCAGTGGCACCACT
GAAGATCTTACTGACAAGGAGGCCGCCCTCAACAGCTCCAACGTCATTACGTTTGTCCAAGACTATCTTACCGCC
AGCCCTCTAGATGTCTACTTTAATGATGTTACCGACGAGGATGCCGCCATGGCTCGGCTAGAATGCGACAAGCTT
CCTAATTTTCTCGACTTGCTTGACACCCAGCTGCAAAAGCAAATAGAGGGTCGCCCTTACCTGAAGGCATTGCCT
AATATACACTTTGTCATTGACCACGCCATCTCCATGTATAGCGATCTTGTCGATACCATTGCCGACGGAAAGAGA
CGCAGCGTCAGGTTCGGCTCTGCCGTCAAATTATCAGTGGGACACCCCATCTCGAGTATAAACCTAGCAATGTGC
CCAACTGCACAGGAGAGTCCTTTCATGTGCGCGGCTTTAACATCCAACCATGCCAAAGACAAGGTCTTCTTCTTT
CGCTCCACTATCGAAATTGTCAGCGGCATAAGCACCACCCAGCCCGTCACGGCGTGCTGCATACATGTTGGTTCT
GTACAAGTACTGGACGCACAGTTCATAGATGGACGGATACTCGTCCTAACTTGCAGCGATCTGGATAACCGCACC
ATCGTCATCCCCGTGTCACACGACCAGAACAGTCTCACTACACAATTGCCGGACGTATACGCTCCCCAGTAA
Transcript >OphauG2|543
ATGGCCAATGCTGCGCCGTGCGAGCTCGCCTTGATGAGCGAGATGCGTCTCGACTATAAGCTCCCTGCCGGCTAC
CCTGTGGCGTGTCCTACAGTCGACTTGGCGGCGGTGCCCGACACCGACGGCAAAGCGCTGCTCGTCAAGCGCCCG
CCTAATTTTGATGTGCTCAAGAGCCACGGGCCGTTTCGGCCGGGGCAACTGCAGGCAGAAGTGGTGGCTGTGACG
TGGCAGAAAGACGGCCAACAAGTCGTAGTCGGCTGGAGCAATGGCTCGGTGCGTCTCGTGGCCCTCGACAACCCG
ACGCCCTCATACCACGCCGAGCTGTGCTGCACACCGCCTGGCACCAAAATCACTCGCATTGGCTGCGCCGTCAAA
CTTGTGTCTACTAGAACACTCGACTTGCCACACGACCATGGACGCCGTCAGCCAAGCCGCCTGCCCCCGGGGTGG
ATCAAGGACAGGCTCTACGTCGACTTTGAGCCCGTGTTGCCCAAGCTCAGTCCCTTTCCCACCAGCAGCGCCGGT
CCAGACGAGCTGGCCACTCTATTCACCCAGCGCGTTGTTTCCGACCTTGTCTCTTCAGACACGTCGAGTACAGAG
GCGCACGACAGCCTCAACTTAATGGTAGTGGGCACTGATGATGGCAAGGTGCAGCTCGTTTTGCATCATTCCCTC
GTTATTGGCATCTTCGACTGTTCAGTGCAGACGCCGTTGGCCACGCCCCGGCTGCTCGACTACGCGTCCAATCCC
CTGCTCTCCACCCAGCTTCTCCTCTTCGCCGACACGGCCCATGAGCCAGAAGACGTCTGGATGGTGCCAATGGAC
CTGCCCTTCCTCATGCCTACCGACTTTAGTCTGTCACACCTGTGCCATATGCTCGCCAACTTGACAAATATTTTC
CGCTATCTCAAGCAGGCTAGCTTGCACCTGGGTGTCGAATGGAAAAACGCCACGGAGCTGCCCAAACGCTTCCTG
CAAAGTGCCCAAGCCACCTTGCGGGAAGCCAAGAATGGGCCTCAAGACGTGACGACAGCCCTCTACCACTTGGCC
CTCAGCGGCCACGCCCACACGCAGTTGCGCGAATGGCTCGTTGACACTGTGGGCGAGCGTGGCCACAAGCGCTGG
GAGAAAGCTGTTGACACGGCCCTCAAGAACATGCGCACTCTTGTCCACGAGAACCTCATTCCTGCAACGGATCGC
TGCGTCATCGTGCTCAGCAGGCTGCATGGCTTTTCCCAGGCTTATACCGACAGCGACCACCTTGACTTTACTCCA
GCCCAAGTCAGCAAAATCACAAACATCGTTAACGGCCTGGCCATTGTCAGCCACGAGATTCTCCAGGATGTCATG
GATCAACTTGAATATTTTGCCACCTTTTCTGATTGGCTCTATTTCCACATTGACCGCTTGACCAGTGGCACCACT
GAAGATCTTACTGACAAGGAGGCCGCCCTCAACAGCTCCAACGTCATTACGTTTGTCCAAGACTATCTTACCGCC
AGCCCTCTAGATGTCTACTTTAATGATGTTACCGACGAGGATGCCGCCATGGCTCGGCTAGAATGCGACAAGCTT
CCTAATTTTCTCGACTTGCTTGACACCCAGCTGCAAAAGCAAATAGAGGGTCGCCCTTACCTGAAGGCATTGCCT
AATATACACTTTGTCATTGACCACGCCATCTCCATGTATAGCGATCTTGTCGATACCATTGCCGACGGAAAGAGA
CGCAGCGTCAGGTTCGGCTCTGCCGTCAAATTATCAGTGGGACACCCCATCTCGAGTATAAACCTAGCAATGTGC
CCAACTGCACAGGAGAGTCCTTTCATGTGCGCGGCTTTAACATCCAACCATGCCAAAGACAAGGTCTTCTTCTTT
CGCTCCACTATCGAAATTGTCAGCGGCATAAGCACCACCCAGCCCGTCACGGCGTGCTGCATACATGTTGGTTCT
GTACAAGTACTGGACGCACAGTTCATAGATGGACGGATACTCGTCCTAACTTGCAGCGATCTGGATAACCGCACC
ATCGTCATCCCCGTGTCACACGACCAGAACAGTCTCACTACACAATTGCCGGACGTATACGCTCCCCAGTAA
Gene >OphauG2|543
ATGGCCAATGCTGCGCCGTGCGAGCTCGCCTTGATGAGCGAGATGCGTCTCGACTATAAGCTCCCTGCCGGCTAC
CCTGTGGCGTGTCCTACAGTCGACTTGGCGGCGGTGCCCGACACCGACGGCAAAGCGCTGCTCGTCAAGCGCCCG
CCTAATTTTGATGTGCTCAAGAGCCACGGGCCGTTTCGGCCGGGGCAACTGCAGGCAGAAGTGGTGGCTGTGACG
TGGCAGAAAGACGGTCAGTAAATATCCATATCTGCATCTACACCTCCTATCTCTGCCTGCTGACGCACCCACGGC
AGGCCAACAAGTCGTAGTCGGCTGGAGCAATGGCTCGGTGCGTCTCGTGGCCCTCGACAACCCGACGCCCTCATA
CCACGCCGAGCTGTGCTGCACACCGCCTGGCACCAAAATCACTCGCATTGGCTGCGCCGTCAAACTTGTGTCTAC
TAGAACACTCGACTTGCCACACGACCATGGACGCCGTCAGCCAAGCCGCCTGCCCCCGGGGTGGATCAAGGACAG
GCTCTACGTCGACTTTGAGCCCGTGTTGCCCAAGCTCAGTCCCTTTCCCACCAGCAGCGCCGGTCCAGAGTAGGT
GCTTGCTAGCCAGGCTGCTGCTGCTATGGCATTGCTGATTTCCACTGTCACTTGCAGCGAGCTGGCCACTCTATT
CACCCAGCGCGTTGTTTCCGACCTTGTCTCTTCAGACACGTCGAGTACAGAGGCGCACGACAGCCTCAACTTAAT
GGTAGTGGGCACTGATGATGGCAAGGTGCAGCTCGTTTTGCATCATTCCCTCGTTATTGGCATCTTCGACTGTTC
AGTGCAGACGCCGTTGGCCACGCCCCGGCTGCTCGACTACGCGTCCAATCCCCTGCTCTCCACCCAGCTTCTCCT
CTTCGCCGACACGGCCCATGAGCCAGAAGACGTCTGGATGGTGCCAATGGACCTGCCCTTCCTCATGCCTACCGA
CTTTAGTCTGTCACACCTGTGCCATATGCTCGCCAACTTGACAAATATTTTCCGCTATCTCAAGCAGGCTAGCTT
GCACCTGGGTGTCGAATGGAAAAACGCCACGGAGCTGCCCAAACGCTTCCTGCAAAGTGCCCAAGCCACCTTGCG
GGAAGCCAAGAATGGGCCTCAAGACGTGACGACAGCCCTCTACCACTTGGCCCTCAGCGGCCACGCCCACACGCA
GTTGCGCGAATGGCTCGTTGACACTGTGGGCGAGCGTGTAGGGCCAGCTCCCTAATCCTCCACTCGTACGTGAGC
CATAATGTGACGCTAACGTAACTCCAAAGGGCCACAAGCGCTGGGAGAAAGCTGTTGACACGGCCCTCAAGAACA
TGCGCACTCTTGTCCACGAGAACCTCATTCCTGCAACGGATCGCTGCGTCATCGTGCTCAGCAGGCTGCATGGCT
TTTCCCAGGCTTATACCGACAGCGACCACCTTGACTTTACTCCAGCCCAAGTCAGCAAAATCACAAACATCGTTA
ACGGCCTGGCCATTGTCAGCCACGAGATTCTCCAGGATGTCATGGATCAACTTGAATATTTTGCCACCTTTTCTG
ATTGGCTCTATTTCCACATTGACCGCTTGACCAGTGGCACCACTGAAGATCTTACTGACAAGGAGGCCGCCCTCA
ACAGCTCCAACGTCATTACGTTTGTCCAAGACTATCTTACCGCCAGCCCTCTAGATGTCTACTTTAATGATGTTA
CCGACGAGGATGCCGCCATGGCTCGGCTAGAATGCGACAAGCTTCCTAATTTTCTCGACTTGCTTGACACCCAGC
TGCAAAAGCAAATAGAGGGTCGCCCTTACCTGAAGGCATTGCCTAATATACACTTTGTCATTGACCACGCCATCT
CCATGTATAGCGATCTTGTCGATACCATTGCCGACGGAAAGAGACGCAGCGTCAGGTTCGGCTCTGCCGTCAAAT
TATCAGTGGGACACCCCATCTCGAGTATAAACCTAGCAATGTGCCCAACTGCACAGGCAAGTTTCTTGTCAACGC
AGCCATACGAGGCAGGTATCCTAATGGGCGTATTCAGGAGAGTCCTTTCATGTGCGCGGCTTTAACATCCAACCA
TGCCAAAGACAAGGGTCAGGGCATTTCATTGGCATCATGCCATCTGCGACGAGCTTCTCGAGTGTCAAGGCTGAT
ATAAGAACAAATAGTCTTCTTCTTTCGCTCCACTATCGAAATTGTCAGCGGCATAAGCACCACCCAGCCCGTCAC
GGCGTGCTGCATACATGTTGGTTCTGTACAAGTACTGGACGCACAGTTCATAGATGGACGGATACTCGTCCTAAC
TTGCAGCGATCTGGGTAAGCCCCCTTGCATCCATTCCAAAGCCATACTTATAATCCAGTGGCAGACTGGGCCTGA
CACTTGGCTTTGCATGACTCCAATGACAATGCTCATGGCCTGACTCTATTTTGTCCAGATAACCGCACCATCGTC
ATCCCCGTGTCACACGACCAGAACAGGTTAGCCTGCGCCCCGTACGACGCAGAGAGCCCCCAAGTCATGGCTATA
GTCTCACTACACAATTGCCGGACGTATACGCTCCCCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail