Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5414
Gene name
LocationContig_5:3599..4709
Strand-
Gene length (bp)1110
Transcript length (bp)1029
Coding sequence length (bp)1029
Protein length (aa) 343

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05652 DcpS Scavenger mRNA decapping enzyme (DcpS) N-terminal 1.1E-32 13 134
PF11969 DcpS_C Scavenger mRNA decapping enzyme C-term binding 4.6E-29 164 283

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7C9|DCPS_SCHPO m7GpppX diphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nhm1 PE=1 SV=1 13 334 7.0E-59
sp|Q06151|DCPS_YEAST m7GpppX diphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCS1 PE=1 SV=1 12 327 8.0E-58
sp|Q12123|DCS2_YEAST Inactive diphosphatase DCS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCS2 PE=1 SV=3 8 331 2.0E-50
sp|D3K0N9|DCPS_ASCSU m7GpppX diphosphatase OS=Ascaris suum PE=1 SV=1 17 303 4.0E-44
sp|G5EFS4|DCPS_CAEEL m7GpppX diphosphatase OS=Caenorhabditis elegans GN=dcs-1 PE=1 SV=1 2 302 1.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7C9|DCPS_SCHPO m7GpppX diphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nhm1 PE=1 SV=1 13 334 7.0E-59
sp|Q06151|DCPS_YEAST m7GpppX diphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCS1 PE=1 SV=1 12 327 8.0E-58
sp|Q12123|DCS2_YEAST Inactive diphosphatase DCS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCS2 PE=1 SV=3 8 331 2.0E-50
sp|D3K0N9|DCPS_ASCSU m7GpppX diphosphatase OS=Ascaris suum PE=1 SV=1 17 303 4.0E-44
sp|G5EFS4|DCPS_CAEEL m7GpppX diphosphatase OS=Caenorhabditis elegans GN=dcs-1 PE=1 SV=1 2 302 1.0E-36
sp|Q96C86|DCPS_HUMAN m7GpppX diphosphatase OS=Homo sapiens GN=DCPS PE=1 SV=2 17 302 2.0E-34
sp|Q8MJJ7|DCPS_BOVIN m7GpppX diphosphatase OS=Bos taurus GN=DCPS PE=2 SV=1 17 281 2.0E-34
sp|Q8MIZ3|DCPS_PIG m7GpppX diphosphatase OS=Sus scrofa GN=DCPS PE=2 SV=1 17 300 2.0E-33
sp|Q9DAR7|DCPS_MOUSE m7GpppX diphosphatase OS=Mus musculus GN=Dcps PE=1 SV=1 17 302 2.0E-33
sp|Q8K4F7|DCPS_RAT m7GpppX diphosphatase OS=Rattus norvegicus GN=Dcps PE=2 SV=1 17 302 6.0E-33
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA Yes
GO:0050789 regulation of biological process No
GO:0000956 nuclear-transcribed mRNA catabolic process No
GO:0110156 methylguanosine-cap decapping No
GO:0010605 negative regulation of macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0034655 nucleobase-containing compound catabolic process No
GO:0044270 cellular nitrogen compound catabolic process No
GO:0008150 biological_process No
GO:0009056 catabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0010468 regulation of gene expression No
GO:0010629 negative regulation of gene expression No
GO:0044238 primary metabolic process No
GO:0016071 mRNA metabolic process No
GO:0006402 mRNA catabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0009057 macromolecule catabolic process No
GO:0009892 negative regulation of metabolic process No
GO:0048519 negative regulation of biological process No
GO:0019222 regulation of metabolic process No
GO:0046700 heterocycle catabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901575 organic substance catabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0019439 aromatic compound catabolic process No
GO:0016070 RNA metabolic process No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0006401 RNA catabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044248 cellular catabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:1901361 organic cyclic compound catabolic process No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0110154 RNA decapping No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0065007 biological regulation No
GO:0043170 macromolecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5414
MDAVVEKQRAEALIPRFELERILNQDQAGRRISLLGKIDGQPALLSVERAPFSLDEGWLSSLPRRFAKVQNLGVN
DVYSWTLAVFTGQDELQQDTSRDEKQEAAQDDKDDFFADVKLNLIFPCTPAHVAKYSKQAVRLVVESPQTYHDAV
RPYMQRKRQHGQLNWVYNIIDGKTEVEDVIYRTPRGQSGDEGFLLAPDLNWDRSTLEALHLLALVERRDMWSLRD
IKKKHIAWLEHMRSKLVAATVATYPSIQPDQLKLYVHYQPTYYHFHIHIVHVALEAGATQATGKAVGLDSIIETL
RVMAGNDETGMDTLTMSYTLGEASELWTHVFAPLKATLQSRQ*
Coding >OphauG2|5414
ATGGATGCAGTGGTTGAAAAGCAGCGTGCCGAGGCGCTCATTCCGCGCTTTGAGCTGGAGCGCATACTCAACCAG
GATCAGGCTGGTCGGCGGATTAGTCTGCTGGGCAAGATTGATGGCCAGCCTGCGCTGCTCAGTGTTGAGCGGGCT
CCCTTTTCCTTGGACGAGGGCTGGCTGTCTAGCCTGCCGCGGCGGTTTGCAAAGGTGCAGAACCTGGGCGTGAAT
GATGTGTATAGTTGGACGTTGGCGGTGTTTACCGGGCAAGACGAATTGCAGCAAGATACAAGTCGAGACGAGAAA
CAAGAGGCAGCACAAGACGACAAGGACGACTTTTTTGCCGACGTCAAGCTCAACCTCATCTTTCCCTGCACGCCG
GCGCACGTGGCAAAGTACTCCAAGCAGGCGGTGCGCCTCGTCGTCGAGTCGCCGCAGACATATCACGATGCCGTC
AGGCCCTACATGCAGCGCAAGCGCCAACACGGCCAACTCAACTGGGTCTACAACATTATCGACGGCAAGACCGAG
GTGGAAGACGTCATTTACAGGACGCCGCGCGGCCAGTCCGGCGACGAGGGCTTCTTGCTGGCGCCCGACCTCAAC
TGGGACCGCAGCACGCTAGAGGCGCTGCATCTACTGGCGCTGGTGGAGCGGCGCGACATGTGGTCGCTGCGCGAT
ATCAAAAAGAAGCATATTGCCTGGCTTGAGCACATGAGGTCCAAGCTCGTTGCTGCCACCGTGGCAACCTATCCC
TCCATCCAGCCCGACCAGCTAAAGCTTTATGTACACTACCAGCCCACCTACTACCACTTCCACATACACATTGTC
CACGTCGCGCTCGAGGCCGGTGCCACGCAGGCAACCGGCAAGGCCGTGGGGCTGGACAGCATCATTGAGACGCTC
AGGGTCATGGCGGGCAATGACGAGACGGGCATGGACACTCTAACCATGAGCTACACGCTCGGCGAGGCCAGTGAG
CTCTGGACGCATGTCTTTGCGCCCCTCAAAGCGACTTTGCAATCTCGTCAATAG
Transcript >OphauG2|5414
ATGGATGCAGTGGTTGAAAAGCAGCGTGCCGAGGCGCTCATTCCGCGCTTTGAGCTGGAGCGCATACTCAACCAG
GATCAGGCTGGTCGGCGGATTAGTCTGCTGGGCAAGATTGATGGCCAGCCTGCGCTGCTCAGTGTTGAGCGGGCT
CCCTTTTCCTTGGACGAGGGCTGGCTGTCTAGCCTGCCGCGGCGGTTTGCAAAGGTGCAGAACCTGGGCGTGAAT
GATGTGTATAGTTGGACGTTGGCGGTGTTTACCGGGCAAGACGAATTGCAGCAAGATACAAGTCGAGACGAGAAA
CAAGAGGCAGCACAAGACGACAAGGACGACTTTTTTGCCGACGTCAAGCTCAACCTCATCTTTCCCTGCACGCCG
GCGCACGTGGCAAAGTACTCCAAGCAGGCGGTGCGCCTCGTCGTCGAGTCGCCGCAGACATATCACGATGCCGTC
AGGCCCTACATGCAGCGCAAGCGCCAACACGGCCAACTCAACTGGGTCTACAACATTATCGACGGCAAGACCGAG
GTGGAAGACGTCATTTACAGGACGCCGCGCGGCCAGTCCGGCGACGAGGGCTTCTTGCTGGCGCCCGACCTCAAC
TGGGACCGCAGCACGCTAGAGGCGCTGCATCTACTGGCGCTGGTGGAGCGGCGCGACATGTGGTCGCTGCGCGAT
ATCAAAAAGAAGCATATTGCCTGGCTTGAGCACATGAGGTCCAAGCTCGTTGCTGCCACCGTGGCAACCTATCCC
TCCATCCAGCCCGACCAGCTAAAGCTTTATGTACACTACCAGCCCACCTACTACCACTTCCACATACACATTGTC
CACGTCGCGCTCGAGGCCGGTGCCACGCAGGCAACCGGCAAGGCCGTGGGGCTGGACAGCATCATTGAGACGCTC
AGGGTCATGGCGGGCAATGACGAGACGGGCATGGACACTCTAACCATGAGCTACACGCTCGGCGAGGCCAGTGAG
CTCTGGACGCATGTCTTTGCGCCCCTCAAAGCGACTTTGCAATCTCGTCAATAG
Gene >OphauG2|5414
ATGGATGCAGTGGTTGAAAAGCAGCGTGCCGAGGCGCTCATTCCGCGCTTTGAGCTGGAGCGCATACTCAACCAG
GGTGAGAGCATTTTGACTCGGCATCTCAAAACACCAAAAACACATGTTTAGAGAGGCCAGGCCTTGCTAACGCGC
TGGTTAGATCAGGCTGGTCGGCGGATTAGTCTGCTGGGCAAGATTGATGGCCAGCCTGCGCTGCTCAGTGTTGAG
CGGGCTCCCTTTTCCTTGGACGAGGGCTGGCTGTCTAGCCTGCCGCGGCGGTTTGCAAAGGTGCAGAACCTGGGC
GTGAATGATGTGTATAGTTGGACGTTGGCGGTGTTTACCGGGCAAGACGAATTGCAGCAAGATACAAGTCGAGAC
GAGAAACAAGAGGCAGCACAAGACGACAAGGACGACTTTTTTGCCGACGTCAAGCTCAACCTCATCTTTCCCTGC
ACGCCGGCGCACGTGGCAAAGTACTCCAAGCAGGCGGTGCGCCTCGTCGTCGAGTCGCCGCAGACATATCACGAT
GCCGTCAGGCCCTACATGCAGCGCAAGCGCCAACACGGCCAACTCAACTGGGTCTACAACATTATCGACGGCAAG
ACCGAGGTGGAAGACGTCATTTACAGGACGCCGCGCGGCCAGTCCGGCGACGAGGGCTTCTTGCTGGCGCCCGAC
CTCAACTGGGACCGCAGCACGCTAGAGGCGCTGCATCTACTGGCGCTGGTGGAGCGGCGCGACATGTGGTCGCTG
CGCGATATCAAAAAGAAGCATATTGCCTGGCTTGAGCACATGAGGTCCAAGCTCGTTGCTGCCACCGTGGCAACC
TATCCCTCCATCCAGCCCGACCAGCTAAAGCTTTATGTACACTACCAGCCCACCTACTACCACTTCCACATACAC
ATTGTCCACGTCGCGCTCGAGGCCGGTGCCACGCAGGCAACCGGCAAGGCCGTGGGGCTGGACAGCATCATTGAG
ACGCTCAGGGTCATGGCGGGCAATGACGAGACGGGCATGGACACTCTAACCATGAGCTACACGCTCGGCGAGGCC
AGTGAGCTCTGGACGCATGTCTTTGCGCCCCTCAAAGCGACTTTGCAATCTCGTCAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail