Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5409
Gene name
LocationContig_499:9391..12090
Strand+
Gene length (bp)2699
Transcript length (bp)2520
Coding sequence length (bp)2520
Protein length (aa) 840

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13589 HATPase_c_3 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 6.1E-15 24 126
PF08676 MutL_C MutL C terminal dimerisation domain 8.1E-06 606 677

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12083|MLH3_YEAST DNA mismatch repair protein MLH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MLH3 PE=1 SV=1 564 804 2.0E-30
sp|Q9UHC1|MLH3_HUMAN DNA mismatch repair protein Mlh3 OS=Homo sapiens GN=MLH3 PE=1 SV=3 507 830 1.0E-25
sp|F4JN26|MLH3_ARATH DNA mismatch repair protein MLH3 OS=Arabidopsis thaliana GN=MLH3 PE=2 SV=2 564 812 5.0E-16
sp|P54279|PMS2_MOUSE Mismatch repair endonuclease PMS2 OS=Mus musculus GN=Pms2 PE=2 SV=1 2 192 3.0E-11
sp|Q92RP4|MUTL_RHIME DNA mismatch repair protein MutL OS=Rhizobium meliloti (strain 1021) GN=mutL PE=3 SV=1 1 221 7.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12083|MLH3_YEAST DNA mismatch repair protein MLH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MLH3 PE=1 SV=1 564 804 2.0E-30
sp|Q9UHC1|MLH3_HUMAN DNA mismatch repair protein Mlh3 OS=Homo sapiens GN=MLH3 PE=1 SV=3 507 830 1.0E-25
sp|F4JN26|MLH3_ARATH DNA mismatch repair protein MLH3 OS=Arabidopsis thaliana GN=MLH3 PE=2 SV=2 564 812 5.0E-16
sp|P54279|PMS2_MOUSE Mismatch repair endonuclease PMS2 OS=Mus musculus GN=Pms2 PE=2 SV=1 2 192 3.0E-11
sp|Q92RP4|MUTL_RHIME DNA mismatch repair protein MutL OS=Rhizobium meliloti (strain 1021) GN=mutL PE=3 SV=1 1 221 7.0E-11
sp|B5YIZ6|MUTL_THEYD DNA mismatch repair protein MutL OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=mutL PE=3 SV=1 3 202 8.0E-11
sp|Q89DE6|MUTL_BRADU DNA mismatch repair protein MutL OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=mutL PE=3 SV=1 1 187 1.0E-10
sp|P54278|PMS2_HUMAN Mismatch repair endonuclease PMS2 OS=Homo sapiens GN=PMS2 PE=1 SV=2 2 192 2.0E-10
sp|A6U6K5|MUTL_SINMW DNA mismatch repair protein MutL OS=Sinorhizobium medicae (strain WSM419) GN=mutL PE=3 SV=1 1 221 2.0E-10
sp|Q219I5|MUTL_RHOPB DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain BisB18) GN=mutL PE=3 SV=1 1 187 3.0E-10
sp|Q941I6|PMS1_ARATH DNA mismatch repair protein PMS1 OS=Arabidopsis thaliana GN=PMS1 PE=1 SV=1 3 192 3.0E-10
sp|B9JA11|MUTL_AGRRK DNA mismatch repair protein MutL OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=mutL PE=3 SV=1 1 221 4.0E-10
sp|Q3ACA6|MUTL_CARHZ DNA mismatch repair protein MutL OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=mutL PE=3 SV=1 3 165 1.0E-09
sp|Q2GJE2|MUTL_ANAPZ DNA mismatch repair protein MutL OS=Anaplasma phagocytophilum (strain HZ) GN=mutL PE=3 SV=1 1 210 2.0E-09
sp|P54277|PMS1_HUMAN PMS1 protein homolog 1 OS=Homo sapiens GN=PMS1 PE=1 SV=1 3 178 2.0E-09
sp|C3MGW0|MUTL_RHISN DNA mismatch repair protein MutL OS=Rhizobium sp. (strain NGR234) GN=mutL PE=3 SV=1 1 221 3.0E-09
sp|Q8P8E4|MUTL_XANCP DNA mismatch repair protein MutL OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=mutL PE=3 SV=1 1 183 4.0E-09
sp|B0RRZ8|MUTL_XANCB DNA mismatch repair protein MutL OS=Xanthomonas campestris pv. campestris (strain B100) GN=mutL PE=3 SV=1 1 183 4.0E-09
sp|Q4UVP3|MUTL_XANC8 DNA mismatch repair protein MutL OS=Xanthomonas campestris pv. campestris (strain 8004) GN=mutL PE=3 SV=1 1 183 4.0E-09
sp|Q5GZ85|MUTL_XANOR DNA mismatch repair protein MutL OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=mutL PE=3 SV=1 1 183 5.0E-09
sp|B2SHP8|MUTL_XANOP DNA mismatch repair protein MutL OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=mutL PE=3 SV=1 1 183 5.0E-09
sp|Q2P295|MUTL_XANOM DNA mismatch repair protein MutL OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=mutL PE=3 SV=1 1 183 5.0E-09
sp|B1ZZY2|MUTL_OPITP DNA mismatch repair protein MutL OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=mutL PE=3 SV=1 3 292 5.0E-09
sp|Q8PJX2|MUTL_XANAC DNA mismatch repair protein MutL OS=Xanthomonas axonopodis pv. citri (strain 306) GN=mutL PE=3 SV=1 1 183 6.0E-09
sp|Q983L2|MUTL_RHILO DNA mismatch repair protein MutL OS=Rhizobium loti (strain MAFF303099) GN=mutL PE=3 SV=1 1 293 7.0E-09
sp|A8F560|MUTL_PSELT DNA mismatch repair protein MutL OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=mutL PE=3 SV=1 1 221 7.0E-09
sp|Q3BSD0|MUTL_XANC5 DNA mismatch repair protein MutL OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=mutL PE=3 SV=1 1 183 8.0E-09
sp|Q6N1N4|MUTL_RHOPA DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=mutL PE=3 SV=1 1 187 9.0E-09
sp|A1SA23|MUTL_SHEAM DNA mismatch repair protein MutL OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=mutL PE=3 SV=1 1 180 1.0E-08
sp|A6VN10|MUTL_ACTSZ DNA mismatch repair protein MutL OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=mutL PE=3 SV=1 1 181 2.0E-08
sp|Q7W4N5|MUTL_BORPA DNA mismatch repair protein MutL OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=mutL PE=3 SV=1 3 320 2.0E-08
sp|B8CX97|MUTL_HALOH DNA mismatch repair protein MutL OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=mutL PE=3 SV=1 3 172 2.0E-08
sp|B3Q7Y9|MUTL_RHOPT DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain TIE-1) GN=mutL PE=3 SV=1 1 187 2.0E-08
sp|Q1QIP3|MUTL_NITHX DNA mismatch repair protein MutL OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=mutL PE=3 SV=1 1 283 3.0E-08
sp|Q7WG61|MUTL_BORBR DNA mismatch repair protein MutL OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=mutL PE=3 SV=1 3 320 4.0E-08
sp|Q9PFB8|MUTL_XYLFA DNA mismatch repair protein MutL OS=Xylella fastidiosa (strain 9a5c) GN=mutL PE=3 SV=1 1 183 4.0E-08
sp|P73349|MUTL_SYNY3 DNA mismatch repair protein MutL OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=mutL PE=3 SV=2 3 195 4.0E-08
sp|A9VS12|MUTL_BACWK DNA mismatch repair protein MutL OS=Bacillus weihenstephanensis (strain KBAB4) GN=mutL PE=3 SV=1 3 270 4.0E-08
sp|Q131I8|MUTL_RHOPS DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain BisB5) GN=mutL PE=3 SV=1 1 187 4.0E-08
sp|B7JY11|MUTL_CYAP8 DNA mismatch repair protein MutL OS=Cyanothece sp. (strain PCC 8801) GN=mutL PE=3 SV=1 3 176 4.0E-08
sp|B5ZS00|MUTL_RHILW DNA mismatch repair protein MutL OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=mutL PE=3 SV=1 1 176 4.0E-08
sp|Q2ISE2|MUTL_RHOP2 DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain HaA2) GN=mutL PE=3 SV=1 1 187 5.0E-08
sp|B0JS91|MUTL_MICAN DNA mismatch repair protein MutL OS=Microcystis aeruginosa (strain NIES-843) GN=mutL PE=3 SV=1 1 162 6.0E-08
sp|Q8UHI3|MUTL_AGRFC DNA mismatch repair protein MutL OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=mutL PE=3 SV=2 1 176 6.0E-08
sp|B6JIV1|MUTL_OLICO DNA mismatch repair protein MutL OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=mutL PE=3 SV=1 1 187 6.0E-08
sp|B1X109|MUTL_CYAA5 DNA mismatch repair protein MutL OS=Cyanothece sp. (strain ATCC 51142) GN=mutL PE=3 SV=1 3 176 6.0E-08
sp|B9JSD6|MUTL_AGRVS DNA mismatch repair protein MutL OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=mutL PE=3 SV=1 1 176 7.0E-08
sp|Q07RR2|MUTL_RHOP5 DNA mismatch repair protein MutL OS=Rhodopseudomonas palustris (strain BisA53) GN=mutL PE=3 SV=1 1 187 7.0E-08
sp|Q7W0A6|MUTL_BORPE DNA mismatch repair protein MutL OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=mutL PE=3 SV=1 3 320 7.0E-08
sp|Q2RQ52|MUTL_RHORT DNA mismatch repair protein MutL OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=mutL PE=3 SV=1 1 306 7.0E-08
sp|Q2KBX7|MUTL_RHIEC DNA mismatch repair protein MutL OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=mutL PE=3 SV=1 1 176 8.0E-08
sp|B2VCU8|MUTL_ERWT9 DNA mismatch repair protein MutL OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=mutL PE=3 SV=1 1 192 8.0E-08
sp|A9IN82|MUTL_BART1 DNA mismatch repair protein MutL OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=mutL PE=3 SV=1 1 176 8.0E-08
sp|B7IHA2|MUTL_THEAB DNA mismatch repair protein MutL OS=Thermosipho africanus (strain TCF52B) GN=mutL PE=3 SV=1 3 195 8.0E-08
sp|Q87L05|MUTL_VIBPA DNA mismatch repair protein MutL OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=mutL PE=3 SV=1 1 178 8.0E-08
sp|P0CAV5|MUTL_CAUCR DNA mismatch repair protein MutL OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=mutL PE=3 SV=1 1 181 1.0E-07
sp|B8H173|MUTL_CAUCN DNA mismatch repair protein MutL OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=mutL PE=3 SV=1 1 181 1.0E-07
sp|B4RA70|MUTL_PHEZH DNA mismatch repair protein MutL OS=Phenylobacterium zucineum (strain HLK1) GN=mutL PE=3 SV=1 1 181 1.0E-07
sp|C3LR77|MUTL_VIBCM DNA mismatch repair protein MutL OS=Vibrio cholerae serotype O1 (strain M66-2) GN=mutL PE=3 SV=1 1 178 1.0E-07
sp|Q9KV13|MUTL_VIBCH DNA mismatch repair protein MutL OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=mutL PE=3 SV=1 1 178 1.0E-07
sp|A5F3L5|MUTL_VIBC3 DNA mismatch repair protein MutL OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=mutL PE=3 SV=1 1 178 1.0E-07
sp|Q1GSN3|MUTL_SPHAL DNA mismatch repair protein MutL OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=mutL PE=3 SV=1 1 175 1.0E-07
sp|Q2VYV5|MUTL_MAGSA DNA mismatch repair protein MutL OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=mutL PE=3 SV=1 1 164 1.0E-07
sp|A5ECL8|MUTL_BRASB DNA mismatch repair protein MutL OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=mutL PE=3 SV=1 1 187 1.0E-07
sp|Q0I463|MUTL_HAES1 DNA mismatch repair protein MutL OS=Haemophilus somnus (strain 129Pt) GN=mutL PE=3 SV=1 1 210 1.0E-07
sp|A4Z0Q5|MUTL_BRASO DNA mismatch repair protein MutL OS=Bradyrhizobium sp. (strain ORS278) GN=mutL PE=3 SV=1 1 187 1.0E-07
sp|B0UUU5|MUTL_HISS2 DNA mismatch repair protein MutL OS=Histophilus somni (strain 2336) GN=mutL PE=3 SV=1 1 210 1.0E-07
sp|Q2KX20|MUTL_BORA1 DNA mismatch repair protein MutL OS=Bordetella avium (strain 197N) GN=mutL PE=3 SV=1 3 164 1.0E-07
sp|A0KSR5|MUTL_SHESA DNA mismatch repair protein MutL OS=Shewanella sp. (strain ANA-3) GN=mutL PE=3 SV=1 1 180 1.0E-07
sp|Q12083|MLH3_YEAST DNA mismatch repair protein MLH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MLH3 PE=1 SV=1 3 302 2.0E-07
sp|F4JN26|MLH3_ARATH DNA mismatch repair protein MLH3 OS=Arabidopsis thaliana GN=MLH3 PE=2 SV=2 2 165 2.0E-07
sp|B0U5C6|MUTL_XYLFM DNA mismatch repair protein MutL OS=Xylella fastidiosa (strain M12) GN=mutL PE=3 SV=1 1 183 2.0E-07
sp|Q87AC9|MUTL_XYLFT DNA mismatch repair protein MutL OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=mutL PE=3 SV=1 1 183 2.0E-07
sp|B2I9E6|MUTL_XYLF2 DNA mismatch repair protein MutL OS=Xylella fastidiosa (strain M23) GN=mutL PE=3 SV=1 1 183 2.0E-07
sp|Q045Q4|MUTL_LACGA DNA mismatch repair protein MutL OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=mutL PE=3 SV=1 3 203 2.0E-07
sp|B1I293|MUTL_DESAP DNA mismatch repair protein MutL OS=Desulforudis audaxviator (strain MP104C) GN=mutL PE=3 SV=1 3 270 2.0E-07
sp|A8YTI0|MUTL_LACH4 DNA mismatch repair protein MutL OS=Lactobacillus helveticus (strain DPC 4571) GN=mutL PE=3 SV=1 3 206 2.0E-07
sp|A6LEJ8|MUTL_PARD8 DNA mismatch repair protein MutL OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=mutL PE=3 SV=1 3 202 2.0E-07
sp|Q1MKU7|MUTL_RHIL3 DNA mismatch repair protein MutL OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=mutL PE=3 SV=1 1 176 2.0E-07
sp|B7LC24|MUTL_ECO55 DNA mismatch repair protein MutL OS=Escherichia coli (strain 55989 / EAEC) GN=mutL PE=3 SV=1 1 183 2.0E-07
sp|Q83P35|MUTL_SHIFL DNA mismatch repair protein MutL OS=Shigella flexneri GN=mutL PE=3 SV=4 1 183 3.0E-07
sp|Q0HR40|MUTL_SHESR DNA mismatch repair protein MutL OS=Shewanella sp. (strain MR-7) GN=mutL PE=3 SV=1 1 180 3.0E-07
sp|A8GQA9|MUTL_RICAH DNA mismatch repair protein MutL OS=Rickettsia akari (strain Hartford) GN=mutL PE=3 SV=1 1 164 3.0E-07
sp|Q0SXB2|MUTL_SHIF8 DNA mismatch repair protein MutL OS=Shigella flexneri serotype 5b (strain 8401) GN=mutL PE=3 SV=1 1 183 3.0E-07
sp|Q31TA0|MUTL_SHIBS DNA mismatch repair protein MutL OS=Shigella boydii serotype 4 (strain Sb227) GN=mutL PE=3 SV=1 1 183 3.0E-07
sp|Q0HMP1|MUTL_SHESM DNA mismatch repair protein MutL OS=Shewanella sp. (strain MR-4) GN=mutL PE=3 SV=1 1 180 3.0E-07
sp|Q941I6|PMS1_ARATH DNA mismatch repair protein PMS1 OS=Arabidopsis thaliana GN=PMS1 PE=1 SV=1 553 798 4.0E-07
sp|A8FRD3|MUTL_SHESH DNA mismatch repair protein MutL OS=Shewanella sediminis (strain HAW-EB3) GN=mutL PE=3 SV=1 1 180 4.0E-07
sp|B3PRD9|MUTL_RHIE6 DNA mismatch repair protein MutL OS=Rhizobium etli (strain CIAT 652) GN=mutL PE=3 SV=1 1 176 4.0E-07
sp|B9DPC0|MUTL_STACT DNA mismatch repair protein MutL OS=Staphylococcus carnosus (strain TM300) GN=mutL PE=3 SV=1 2 176 4.0E-07
sp|A5V3J3|MUTL_SPHWW DNA mismatch repair protein MutL OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=mutL PE=3 SV=1 1 175 4.0E-07
sp|P54280|PMS1_SCHPO DNA mismatch repair protein pms1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pms1 PE=3 SV=1 2 196 4.0E-07
sp|B6I274|MUTL_ECOSE DNA mismatch repair protein MutL OS=Escherichia coli (strain SE11) GN=mutL PE=3 SV=1 1 183 5.0E-07
sp|A8A7R4|MUTL_ECOHS DNA mismatch repair protein MutL OS=Escherichia coli O9:H4 (strain HS) GN=mutL PE=3 SV=1 1 183 5.0E-07
sp|A7ZV39|MUTL_ECO24 DNA mismatch repair protein MutL OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mutL PE=3 SV=1 1 183 5.0E-07
sp|Q3YUH3|MUTL_SHISS DNA mismatch repair protein MutL OS=Shigella sonnei (strain Ss046) GN=mutL PE=3 SV=1 1 183 5.0E-07
sp|B2TY45|MUTL_SHIB3 DNA mismatch repair protein MutL OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mutL PE=3 SV=1 1 183 5.0E-07
sp|P23367|MUTL_ECOLI DNA mismatch repair protein MutL OS=Escherichia coli (strain K12) GN=mutL PE=1 SV=2 1 183 5.0E-07
sp|B1XDS1|MUTL_ECODH DNA mismatch repair protein MutL OS=Escherichia coli (strain K12 / DH10B) GN=mutL PE=3 SV=1 1 183 5.0E-07
sp|C5A1G1|MUTL_ECOBW DNA mismatch repair protein MutL OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mutL PE=3 SV=1 1 183 5.0E-07
sp|B7M8T0|MUTL_ECO8A DNA mismatch repair protein MutL OS=Escherichia coli O8 (strain IAI1) GN=mutL PE=3 SV=1 1 183 5.0E-07
sp|A0LZH8|MUTL_GRAFK DNA mismatch repair protein MutL OS=Gramella forsetii (strain KT0803) GN=mutL PE=3 SV=1 3 186 5.0E-07
sp|Q3SIQ5|MUTL_THIDA DNA mismatch repair protein MutL OS=Thiobacillus denitrificans (strain ATCC 25259) GN=mutL PE=3 SV=1 1 303 5.0E-07
sp|Q8XDN4|MUTL_ECO57 DNA mismatch repair protein MutL OS=Escherichia coli O157:H7 GN=mutL PE=3 SV=1 1 183 6.0E-07
sp|Q6D065|MUTL_PECAS DNA mismatch repair protein MutL OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mutL PE=3 SV=1 1 192 6.0E-07
sp|B1LQJ0|MUTL_ECOSM DNA mismatch repair protein MutL OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mutL PE=3 SV=1 1 183 6.0E-07
sp|B5Z2H6|MUTL_ECO5E DNA mismatch repair protein MutL OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mutL PE=3 SV=1 1 183 6.0E-07
sp|B7UQH9|MUTL_ECO27 DNA mismatch repair protein MutL OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mutL PE=3 SV=1 1 183 6.0E-07
sp|B7MSY3|MUTL_ECO81 DNA mismatch repair protein MutL OS=Escherichia coli O81 (strain ED1a) GN=mutL PE=3 SV=1 1 183 6.0E-07
sp|Q0T9M3|MUTL_ECOL5 DNA mismatch repair protein MutL OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mutL PE=3 SV=1 1 183 6.0E-07
sp|A1AJ76|MUTL_ECOK1 DNA mismatch repair protein MutL OS=Escherichia coli O1:K1 / APEC GN=mutL PE=3 SV=1 1 183 6.0E-07
sp|B7MKX4|MUTL_ECO45 DNA mismatch repair protein MutL OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mutL PE=3 SV=1 1 183 6.0E-07
sp|Q328E9|MUTL_SHIDS DNA mismatch repair protein MutL OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mutL PE=3 SV=1 1 183 7.0E-07
sp|Q8FAK9|MUTL_ECOL6 DNA mismatch repair protein MutL OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mutL PE=3 SV=2 1 183 7.0E-07
sp|B1IT36|MUTL_ECOLC DNA mismatch repair protein MutL OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mutL PE=3 SV=1 1 183 7.0E-07
sp|Q3MEV6|MUTL_ANAVT DNA mismatch repair protein MutL OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=mutL PE=3 SV=1 2 176 7.0E-07
sp|Q65SD7|MUTL_MANSM DNA mismatch repair protein MutL OS=Mannheimia succiniciproducens (strain MBEL55E) GN=mutL PE=3 SV=1 1 289 8.0E-07
sp|P57886|MUTL_PASMU DNA mismatch repair protein MutL OS=Pasteurella multocida (strain Pm70) GN=mutL PE=3 SV=1 1 181 8.0E-07
sp|B0SWX9|MUTL_CAUSK DNA mismatch repair protein MutL OS=Caulobacter sp. (strain K31) GN=mutL PE=3 SV=1 1 181 8.0E-07
sp|Q8CPE9|MUTL_STAES DNA mismatch repair protein MutL OS=Staphylococcus epidermidis (strain ATCC 12228) GN=mutL PE=3 SV=1 3 176 8.0E-07
sp|Q5HPP4|MUTL_STAEQ DNA mismatch repair protein MutL OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=mutL PE=3 SV=1 3 176 8.0E-07
sp|Q7MH01|MUTL_VIBVY DNA mismatch repair protein MutL OS=Vibrio vulnificus (strain YJ016) GN=mutL PE=3 SV=1 1 178 1.0E-06
sp|Q11Z58|MUTL_CYTH3 DNA mismatch repair protein MutL OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=mutL PE=3 SV=1 3 229 1.0E-06
sp|C6DFJ9|MUTL_PECCP DNA mismatch repair protein MutL OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mutL PE=3 SV=1 1 192 1.0E-06
sp|A5FW68|MUTL_ACICJ DNA mismatch repair protein MutL OS=Acidiphilium cryptum (strain JF-5) GN=mutL PE=3 SV=1 1 281 1.0E-06
sp|Q8DCV0|MUTL_VIBVU DNA mismatch repair protein MutL OS=Vibrio vulnificus (strain CMCP6) GN=mutL PE=3 SV=1 1 178 1.0E-06
sp|A8AMN1|MUTL_CITK8 DNA mismatch repair protein MutL OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mutL PE=3 SV=1 1 193 1.0E-06
sp|A7MMA2|MUTL_CROS8 DNA mismatch repair protein MutL OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mutL PE=3 SV=1 1 183 1.0E-06
sp|B3PDC3|MUTL_CELJU DNA mismatch repair protein MutL OS=Cellvibrio japonicus (strain Ueda107) GN=mutL PE=3 SV=1 3 164 1.0E-06
sp|Q07XW5|MUTL_SHEFN DNA mismatch repair protein MutL OS=Shewanella frigidimarina (strain NCIMB 400) GN=mutL PE=3 SV=1 1 180 2.0E-06
sp|Q2LUR5|MUTL_SYNAS DNA mismatch repair protein MutL OS=Syntrophus aciditrophicus (strain SB) GN=mutL PE=3 SV=1 6 174 2.0E-06
sp|A0B977|MUTL_METTP DNA mismatch repair protein MutL OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=mutL PE=3 SV=1 3 165 2.0E-06
sp|Q3IDU0|MUTL_PSEHT DNA mismatch repair protein MutL OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=mutL PE=3 SV=1 1 178 2.0E-06
sp|P65492|MUTL_STAAN DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain N315) GN=mutL PE=1 SV=1 3 176 2.0E-06
sp|P65491|MUTL_STAAM DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=mutL PE=3 SV=1 3 176 2.0E-06
sp|A6U1B5|MUTL_STAA2 DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain JH1) GN=mutL PE=3 SV=1 3 176 2.0E-06
sp|A7X1T8|MUTL_STAA1 DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=mutL PE=3 SV=1 3 176 2.0E-06
sp|A8Z1W7|MUTL_STAAT DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=mutL PE=3 SV=1 3 176 2.0E-06
sp|A6QGJ5|MUTL_STAAE DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain Newman) GN=mutL PE=3 SV=1 3 176 2.0E-06
sp|Q5HGD5|MUTL_STAAC DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain COL) GN=mutL PE=3 SV=1 3 176 2.0E-06
sp|Q93T05|MUTL_STAA8 DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain NCTC 8325) GN=mutL PE=3 SV=2 3 176 2.0E-06
sp|Q2FHE2|MUTL_STAA3 DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain USA300) GN=mutL PE=3 SV=1 3 176 2.0E-06
sp|Q8NWX9|MUTL_STAAW DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain MW2) GN=mutL PE=3 SV=1 3 176 3.0E-06
sp|Q6G9R7|MUTL_STAAS DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain MSSA476) GN=mutL PE=3 SV=1 3 176 3.0E-06
sp|Q6GHD9|MUTL_STAAR DNA mismatch repair protein MutL OS=Staphylococcus aureus (strain MRSA252) GN=mutL PE=3 SV=1 3 176 3.0E-06
sp|B4F203|MUTL_PROMH DNA mismatch repair protein MutL OS=Proteus mirabilis (strain HI4320) GN=mutL PE=3 SV=1 1 183 4.0E-06
sp|Q9RTR0|MUTL_DEIRA DNA mismatch repair protein MutL OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=mutL PE=3 SV=1 3 172 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006298 mismatch repair Yes
GO:0005524 ATP binding Yes
GO:0006259 DNA metabolic process No
GO:0000166 nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No
GO:0046483 heterocycle metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No
GO:0006950 response to stress No
GO:0043167 ion binding No
GO:0006281 DNA repair No
GO:0008150 biological_process No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0033554 cellular response to stress No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0044260 cellular macromolecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0006725 cellular aromatic compound metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0051716 cellular response to stimulus No
GO:0050896 response to stimulus No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup646
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5409 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3825
Ophiocordyceps camponoti-floridani Ophcf2|03712
Ophiocordyceps camponoti-rufipedis Ophun1|4181
Ophiocordyceps kimflemingae Ophio5|1259
Ophiocordyceps subramaniannii Hirsu2|10517
Ophiocordyceps subramaniannii Hirsu2|10518

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5409
MSIRQLPDHVVDQLESASAITCLNAVVCGLLKNSLDAGCTRANIHINYLHGNCSVQDDGLGIEPCEFKDGGGLAK
PHHTSRITPSSSSCHGSRGDFLASVANMSLLSIISHHAAYMSHGHLSIHNSNVLARQMPAPPDKCLEVFSHGTHV
SVRSLFGSMPVRVKHRATVFSERSAIDKEWRTLVRHLVALLLAWPSEVSLSLTETAIHRHLRLRSALYADMCART
SSLLTQASLANSADAVSWVPVSVCNSHLRIKGCISTRPVASRRSQLMSLGIRPILDDHNFNVLYESVNHVFANSA
FGLVQDENGGDGEATVKSRKGPDKWPMFYFHITLISPEKPLGHTLIGDKVLDNITMLIHTACHDFLQKQHLRPRA
LNRRAPTRQAAKRRNNPSGLSQSATPLDSTASLSGTRLADQAMLGFVSPFEDWHRIKIGVAAPRREAKSPRNSRR
MVGEGGKLLRLPFENLPDVSSNDETQTQGGGSLGGDGPVKRSKRLRIIDKSPKPQPSPWLQSVLTSWENPVFEIA
QGSIPRLYEDATPLDTARCSPSSRHVNLEAKSMSLAGRVSKSALTNAEVIGQVDRKFILVKLPLESVVKRTVETN
QPRVPALVMIDQHAADERCKLEELMAGYFERKPTKGSYEAVVERLEQPMVFEVADQEGEMLQRYHGHFASWGIHY
SVQRGRREQHTAKMCITQLPTSIVERCRSEPRLTIDLVRKEIWLIHDETKTCSLPYTGDEAGRPPRPHFHGCPAG
ILDLLYSRSCRSAIMFNDELSREQCQQLVRQLAQCAFPFQCAHGRPSMVPLADLGTGHDAVSWQHRRHSDLSMWK
KWLQSSQPSHVPLS*
Coding >OphauG2|5409
ATGTCCATCCGCCAGCTCCCCGACCATGTCGTGGACCAACTCGAGTCGGCATCCGCCATCACTTGTCTCAACGCC
GTTGTCTGTGGGCTGCTCAAAAATTCGCTAGACGCTGGTTGCACAAGGGCCAACATCCACATCAACTACCTCCAT
GGAAATTGCAGTGTCCAAGACGACGGACTCGGCATTGAGCCCTGCGAGTTCAAGGATGGCGGAGGCCTGGCAAAG
CCGCATCACACGTCGCGAATCACTCCAAGCTCCTCCAGCTGCCACGGAAGCCGCGGCGACTTTCTGGCATCGGTA
GCAAACATGTCGCTGCTCTCCATCATCTCGCATCATGCCGCATACATGTCCCACGGCCATCTCTCAATCCACAAC
TCCAATGTTTTGGCCAGGCAGATGCCTGCACCTCCAGACAAGTGCCTCGAGGTTTTCAGCCATGGAACACATGTC
TCTGTGCGATCCTTGTTTGGTTCCATGCCTGTTCGGGTCAAACATCGCGCGACTGTCTTTTCTGAGCGCTCCGCC
ATCGACAAGGAATGGCGAACTCTTGTTCGTCATCTTGTCGCCTTGCTCCTGGCATGGCCGTCTGAGGTGTCGCTT
TCTTTGACCGAGACAGCCATCCACCGCCACTTGCGCCTCAGGTCTGCCCTGTATGCAGACATGTGCGCCCGTACC
TCGAGCCTCTTGACTCAGGCCTCTCTAGCTAATTCAGCCGACGCTGTCTCATGGGTCCCTGTTTCCGTCTGTAAT
TCCCACCTTCGCATCAAAGGCTGTATCTCGACGAGACCTGTCGCCTCACGTCGCTCTCAGCTCATGAGCTTGGGC
ATACGTCCCATTCTTGACGACCATAATTTCAATGTGCTTTACGAGTCAGTCAACCACGTCTTTGCCAACTCTGCC
TTTGGTCTCGTCCAAGATGAAAATGGCGGTGATGGAGAAGCAACTGTAAAGTCCCGAAAGGGACCGGATAAATGG
CCCATGTTTTATTTTCACATTACACTCATAAGCCCAGAAAAGCCTCTGGGTCATACATTGATTGGTGACAAGGTT
CTGGACAATATCACAATGCTGATTCACACGGCGTGCCACGACTTTCTTCAGAAGCAACATCTGCGCCCACGGGCC
TTGAATCGACGTGCTCCCACTCGACAAGCTGCAAAACGGCGCAACAACCCCTCTGGCCTGTCGCAATCAGCCACG
CCACTCGATTCAACAGCATCTCTTTCCGGTACCCGACTGGCTGATCAAGCCATGCTTGGTTTTGTCAGTCCTTTT
GAGGATTGGCATCGCATCAAGATCGGTGTAGCGGCTCCAAGAAGAGAGGCCAAGTCTCCGCGCAATAGCCGCCGT
ATGGTCGGAGAGGGGGGTAAACTGCTTCGCCTACCATTTGAGAACTTGCCAGATGTAAGCAGCAATGATGAGACC
CAGACACAGGGGGGTGGAAGCCTTGGGGGCGACGGCCCCGTCAAGCGCTCCAAGAGGCTGCGAATCATTGACAAA
TCACCCAAGCCTCAACCAAGTCCCTGGCTTCAGAGTGTCCTCACATCATGGGAGAACCCTGTGTTTGAAATAGCA
CAAGGATCAATTCCAAGGCTATACGAGGATGCTACGCCATTGGATACCGCCAGATGCAGCCCCAGTAGTCGGCAC
GTGAATCTCGAAGCGAAGTCGATGAGCCTGGCTGGGCGTGTCTCGAAATCCGCCTTGACTAATGCCGAGGTGATT
GGCCAGGTCGACCGCAAATTTATCCTTGTCAAGCTGCCGCTTGAGAGCGTCGTCAAACGCACAGTTGAAACCAAT
CAACCAAGGGTCCCGGCATTGGTCATGATTGATCAGCATGCTGCTGACGAGCGGTGCAAGCTGGAGGAGCTGATG
GCGGGGTATTTTGAAAGGAAGCCAACCAAGGGCTCGTATGAAGCAGTTGTTGAACGGCTAGAGCAACCCATGGTT
TTCGAGGTGGCCGATCAAGAGGGAGAGATGCTACAGCGATATCATGGGCATTTTGCATCGTGGGGTATACACTAC
AGCGTCCAAAGAGGGAGAAGGGAGCAGCACACAGCCAAGATGTGCATTACCCAGCTACCCACGAGCATTGTCGAG
CGCTGTCGCAGCGAGCCGCGTTTGACGATAGATCTTGTGCGAAAGGAAATATGGCTGATCCACGATGAGACCAAG
ACGTGTAGCCTACCCTATACTGGCGATGAGGCTGGCCGGCCACCAAGGCCGCACTTCCACGGCTGTCCGGCAGGC
ATCCTGGACCTTTTATACTCTCGGTCCTGTCGCAGTGCCATCATGTTCAACGACGAGCTGTCAAGAGAGCAATGC
CAGCAGCTGGTGCGGCAACTGGCCCAGTGCGCGTTTCCCTTTCAATGCGCCCATGGCCGACCGAGCATGGTGCCC
CTTGCTGATCTCGGAACTGGCCATGATGCTGTGTCATGGCAGCATCGACGTCACTCGGATCTGTCCATGTGGAAG
AAATGGCTGCAAAGCTCCCAACCAAGCCATGTACCCCTATCTTGA
Transcript >OphauG2|5409
ATGTCCATCCGCCAGCTCCCCGACCATGTCGTGGACCAACTCGAGTCGGCATCCGCCATCACTTGTCTCAACGCC
GTTGTCTGTGGGCTGCTCAAAAATTCGCTAGACGCTGGTTGCACAAGGGCCAACATCCACATCAACTACCTCCAT
GGAAATTGCAGTGTCCAAGACGACGGACTCGGCATTGAGCCCTGCGAGTTCAAGGATGGCGGAGGCCTGGCAAAG
CCGCATCACACGTCGCGAATCACTCCAAGCTCCTCCAGCTGCCACGGAAGCCGCGGCGACTTTCTGGCATCGGTA
GCAAACATGTCGCTGCTCTCCATCATCTCGCATCATGCCGCATACATGTCCCACGGCCATCTCTCAATCCACAAC
TCCAATGTTTTGGCCAGGCAGATGCCTGCACCTCCAGACAAGTGCCTCGAGGTTTTCAGCCATGGAACACATGTC
TCTGTGCGATCCTTGTTTGGTTCCATGCCTGTTCGGGTCAAACATCGCGCGACTGTCTTTTCTGAGCGCTCCGCC
ATCGACAAGGAATGGCGAACTCTTGTTCGTCATCTTGTCGCCTTGCTCCTGGCATGGCCGTCTGAGGTGTCGCTT
TCTTTGACCGAGACAGCCATCCACCGCCACTTGCGCCTCAGGTCTGCCCTGTATGCAGACATGTGCGCCCGTACC
TCGAGCCTCTTGACTCAGGCCTCTCTAGCTAATTCAGCCGACGCTGTCTCATGGGTCCCTGTTTCCGTCTGTAAT
TCCCACCTTCGCATCAAAGGCTGTATCTCGACGAGACCTGTCGCCTCACGTCGCTCTCAGCTCATGAGCTTGGGC
ATACGTCCCATTCTTGACGACCATAATTTCAATGTGCTTTACGAGTCAGTCAACCACGTCTTTGCCAACTCTGCC
TTTGGTCTCGTCCAAGATGAAAATGGCGGTGATGGAGAAGCAACTGTAAAGTCCCGAAAGGGACCGGATAAATGG
CCCATGTTTTATTTTCACATTACACTCATAAGCCCAGAAAAGCCTCTGGGTCATACATTGATTGGTGACAAGGTT
CTGGACAATATCACAATGCTGATTCACACGGCGTGCCACGACTTTCTTCAGAAGCAACATCTGCGCCCACGGGCC
TTGAATCGACGTGCTCCCACTCGACAAGCTGCAAAACGGCGCAACAACCCCTCTGGCCTGTCGCAATCAGCCACG
CCACTCGATTCAACAGCATCTCTTTCCGGTACCCGACTGGCTGATCAAGCCATGCTTGGTTTTGTCAGTCCTTTT
GAGGATTGGCATCGCATCAAGATCGGTGTAGCGGCTCCAAGAAGAGAGGCCAAGTCTCCGCGCAATAGCCGCCGT
ATGGTCGGAGAGGGGGGTAAACTGCTTCGCCTACCATTTGAGAACTTGCCAGATGTAAGCAGCAATGATGAGACC
CAGACACAGGGGGGTGGAAGCCTTGGGGGCGACGGCCCCGTCAAGCGCTCCAAGAGGCTGCGAATCATTGACAAA
TCACCCAAGCCTCAACCAAGTCCCTGGCTTCAGAGTGTCCTCACATCATGGGAGAACCCTGTGTTTGAAATAGCA
CAAGGATCAATTCCAAGGCTATACGAGGATGCTACGCCATTGGATACCGCCAGATGCAGCCCCAGTAGTCGGCAC
GTGAATCTCGAAGCGAAGTCGATGAGCCTGGCTGGGCGTGTCTCGAAATCCGCCTTGACTAATGCCGAGGTGATT
GGCCAGGTCGACCGCAAATTTATCCTTGTCAAGCTGCCGCTTGAGAGCGTCGTCAAACGCACAGTTGAAACCAAT
CAACCAAGGGTCCCGGCATTGGTCATGATTGATCAGCATGCTGCTGACGAGCGGTGCAAGCTGGAGGAGCTGATG
GCGGGGTATTTTGAAAGGAAGCCAACCAAGGGCTCGTATGAAGCAGTTGTTGAACGGCTAGAGCAACCCATGGTT
TTCGAGGTGGCCGATCAAGAGGGAGAGATGCTACAGCGATATCATGGGCATTTTGCATCGTGGGGTATACACTAC
AGCGTCCAAAGAGGGAGAAGGGAGCAGCACACAGCCAAGATGTGCATTACCCAGCTACCCACGAGCATTGTCGAG
CGCTGTCGCAGCGAGCCGCGTTTGACGATAGATCTTGTGCGAAAGGAAATATGGCTGATCCACGATGAGACCAAG
ACGTGTAGCCTACCCTATACTGGCGATGAGGCTGGCCGGCCACCAAGGCCGCACTTCCACGGCTGTCCGGCAGGC
ATCCTGGACCTTTTATACTCTCGGTCCTGTCGCAGTGCCATCATGTTCAACGACGAGCTGTCAAGAGAGCAATGC
CAGCAGCTGGTGCGGCAACTGGCCCAGTGCGCGTTTCCCTTTCAATGCGCCCATGGCCGACCGAGCATGGTGCCC
CTTGCTGATCTCGGAACTGGCCATGATGCTGTGTCATGGCAGCATCGACGTCACTCGGATCTGTCCATGTGGAAG
AAATGGCTGCAAAGCTCCCAACCAAGCCATGTACCCCTATCTTGA
Gene >OphauG2|5409
ATGTCCATCCGCCAGCTCCCCGACCATGTCGTGGACCAACTCGAGTCGGCATCCGCCATCACTTGTCTCAACGCC
GTTGTCTGTGGGCTGCTCAAAAATTCGCTAGACGCTGGTTGCACAAGGGCCAACATCCACATCAACTACCTCCAT
GGAAATTGCAGTGTCCAAGACGACGGACTCGGCATTGAGCCCTGCGAGTTCAAGGATGGCGGAGGCCTGGCAAAG
CCGCATCGTGAGCCATGGCCCCCTTCTAATGGCCCCCTTCCAATGGCCCCCTTCAACGGACCGCTTCTCATGGCC
CCCTTTGTCACGACCCCCCTTGCAAGCTGACGTGCAATACATGTCAGACACGTCGCGAATCACTCCAAGCTCCTC
CAGCTGCCACGGAAGCCGCGGCGACTTTCTGGCATCGGTAGCAAACATGTCGCTGCTCTCCATCATCTCGCATCA
TGCCGCATACATGTCCCACGGCCATCTCTCAATCCACAACTCCAATGTTTTGGCCAGGCAGATGCCTGCACCTCC
AGACAAGTGCCTCGAGGTTTTCAGCCATGGAACACATGTCTCTGTGCGATCCTTGTTTGGTTCCATGCCTGTTCG
GGTCAAACATCGCGCGACTGTCTTTTCTGAGCGCTCCGCCATCGACAAGGAATGGCGAACTCTTGTTCGTCATCT
TGTCGCCTTGCTCCTGGCATGGCCGTCTGAGGTGTCGCTTTCTTTGACCGAGACAGCCATCCACCGCCACTTGCG
CCTCAGGTCTGCCCTGTATGCAGACATGTGCGCCCGTACCTCGAGCCTCTTGACTCAGGCCTCTCTAGCTAATTC
AGCCGACGCTGTCTCATGGGTCCCTGTTTCCGTCTGTAATTCCCACCTTCGCATCAAAGGCTGTATCTCGACGAG
ACCTGTCGCCTCACGTCGCTCTCAGCTCATGAGCTTGGGCATACGTCCCATTCTTGACGACCATAATTTCAATGT
GCTTTACGAGTCAGTCAACCACGTCTTTGCCAACTCTGCCTTTGGTCTCGTCCAAGATGAAAATGGCGGTGATGG
AGAAGCAACTGTAAAGTCCCGAAAGGGACCGGATAAATGGCCCATGTTTTATTTTCACATTACACTCATAAGCCC
AGAAAAGCCTCTGGGTCATACATTGATTGGTGACAAGGTTCTGGACAATATCACAATGCTGATTCACACGGCGTG
CCACGACTTTCTTCAGAAGCAACATCTGCGCCCACGGGCCTTGAATCGACGTGCTCCCACTCGACAAGCTGCAAA
ACGGCGCAACAACCCCTCTGGCCTGTCGCAATCAGCCACGCCACTCGATTCAACAGCATCTCTTTCCGGTACCCG
ACTGGCTGATCAAGCCATGCTTGGTTTTGTCAGTCCTTTTGAGGATTGGCATCGCATCAAGATCGGTGTAGCGGC
TCCAAGAAGAGAGGCCAAGTCTCCGCGCAATAGCCGCCGTATGGTCGGAGAGGGGGGTAAACTGCTTCGCCTACC
ATTTGAGAACTTGCCAGATGTAAGCAGCAATGATGAGACCCAGACACAGGGGGGTGGAAGCCTTGGGGGCGACGG
CCCCGTCAAGCGCTCCAAGAGGCTGCGAATCATTGACAAATCACCCAAGCCTCAACCAAGTCCCTGGCTTCAGAG
TGTCCTCACATCATGGGAGAACCCTGTGTTTGAAATAGCACAAGGATCAATTCCAAGGCTATACGAGGATGCTAC
GCCATTGGATACCGCCAGATGCAGCCCCAGTAGTCGGCACGTGAATCTCGAAGCGAAGTCGATGAGCCTGGCTGG
GCGTGTCTCGAAATCCGCCTTGACTAATGCCGAGGTGATTGGCCAGGTCGACCGCAAATTTATCCTTGTCAAGCT
GCCGCTTGAGAGCGTCGTCAAACGCACAGTTGAAACCAATCAACCAAGGGTCCCGGCATTGGTCATGATTGATCA
GCATGCTGCTGACGAGCGGTGCAAGCTGGAGGAGCTGATGGCGGGGTATTTTGAAAGGAAGCCAACCAAGGGCTC
GTATGAAGCAGTTGTTGAACGGCTAGAGCAACCCATGGTTTTCGAGGTGGCCGATCAAGAGGGAGAGATGCTACA
GCGATATCATGGGCATTTTGCATCGTGGGGTATACACTACAGCGTCCAAAGAGGGAGAAGGGAGCAGCACACAGC
CAAGATGTGCATTACCCAGCTACCCACGAGCATTGTCGAGCGCTGTCGCAGCGAGCCGCGTTTGACGATAGATCT
TGTGCGAAAGGAAATATGGCTGATCCACGATGAGACCAAGACGTGTAGCCTACCCTATACTGGCGATGAGGCTGG
CCGGCCACCAAGGCCGCACTTCCACGGCTGTCCGGCAGGCATCCTGGACCTTTTATACTCTCGGTCCTGTCGCAG
TAGGCCTGCCTGGACCAGGTGACGGATGACTGGTTTGTGCAGCTTGCTGACGACGGAGCATAGGTGCCATCATGT
TCAACGACGAGCTGTCAAGAGAGCAATGCCAGCAGCTGGTGCGGCAACTGGCCCAGTGCGCGTTTCCCTTTCAAT
GCGCCCATGGCCGACCGAGCATGGTGCCCCTTGCTGATCTCGGAACTGGCCATGATGCTGTGTCATGGCAGCATC
GACGTCACTCGGATCTGTCCATGTGGAAGAAATGGCTGCAAAGCTCCCAACCAAGCCATGTACCCCTATCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail