Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5400
Gene name
LocationContig_498:228..1115
Strand-
Gene length (bp)887
Transcript length (bp)726
Coding sequence length (bp)726
Protein length (aa) 242

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00650 CRAL_TRIO CRAL/TRIO domain 1.3E-36 112 233
PF03765 CRAL_TRIO_N CRAL/TRIO, N-terminal domain 2.8E-13 31 88

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UU99|YJX4_SCHPO CRAL-TRIO domain-containing protein C23B6.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC23B6.04c PE=1 SV=1 23 233 1.0E-72
sp|P53860|PDR16_YEAST Phosphatidylinositol transfer protein PDR16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR16 PE=1 SV=1 7 233 3.0E-71
sp|P53844|PDR17_YEAST Phosphatidylinositol transfer protein PDR17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR17 PE=1 SV=1 6 235 5.0E-56
sp|P24280|SEC14_YEAST SEC14 cytosolic factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC14 PE=1 SV=3 64 233 6.0E-20
sp|Q55CU8|RSC5_DICDI Random slug protein 5 OS=Dictyostelium discoideum GN=rsc5 PE=2 SV=1 63 233 5.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UU99|YJX4_SCHPO CRAL-TRIO domain-containing protein C23B6.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC23B6.04c PE=1 SV=1 23 233 1.0E-72
sp|P53860|PDR16_YEAST Phosphatidylinositol transfer protein PDR16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR16 PE=1 SV=1 7 233 3.0E-71
sp|P53844|PDR17_YEAST Phosphatidylinositol transfer protein PDR17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR17 PE=1 SV=1 6 235 5.0E-56
sp|P24280|SEC14_YEAST SEC14 cytosolic factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC14 PE=1 SV=3 64 233 6.0E-20
sp|Q55CU8|RSC5_DICDI Random slug protein 5 OS=Dictyostelium discoideum GN=rsc5 PE=2 SV=1 63 233 5.0E-19
sp|P53989|SEC14_CANGA SEC14 cytosolic factor OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC14 PE=3 SV=1 64 233 5.0E-18
sp|Q75DK1|SEC14_ASHGO SEC14 cytosolic factor OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC14 PE=3 SV=2 64 233 2.0E-16
sp|P24859|SEC14_KLULA SEC14 cytosolic factor OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC14 PE=3 SV=2 64 233 1.0E-15
sp|Q9M0R2|PATL5_ARATH Patellin-5 OS=Arabidopsis thaliana GN=PATL5 PE=1 SV=2 25 233 3.0E-15
sp|P33324|YKJ1_YEAST CRAL-TRIO domain-containing protein YKL091C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL091C PE=1 SV=2 17 233 4.0E-15
sp|Q10138|YAS2_SCHPO CRAL-TRIO domain-containing protein C3H8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H8.02 PE=1 SV=1 69 233 1.0E-13
sp|Q56Z59|PATL3_ARATH Patellin-3 OS=Arabidopsis thaliana GN=PATL3 PE=1 SV=2 68 233 2.0E-13
sp|P45816|SEC14_YARLI SEC14 cytosolic factor OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC14 PE=3 SV=2 68 233 2.0E-13
sp|P46250|SEC14_CANAL SEC14 cytosolic factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC14 PE=2 SV=1 64 233 6.0E-13
sp|Q94C59|PATL4_ARATH Patellin-4 OS=Arabidopsis thaliana GN=PATL4 PE=1 SV=2 68 241 2.0E-12
sp|Q9SCU1|PATL6_ARATH Patellin-6 OS=Arabidopsis thaliana GN=PATL6 PE=2 SV=1 68 233 8.0E-12
sp|Q10137|SEC14_SCHPO Sec14 cytosolic factor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec14 PE=3 SV=1 64 233 8.0E-12
sp|Q16KN5|RETM_AEDAE Protein real-time OS=Aedes aegypti GN=retm PE=3 SV=1 48 235 6.0E-11
sp|Q7PWB1|RETM_ANOGA Protein real-time OS=Anopheles gambiae GN=retm PE=3 SV=4 67 235 1.0E-10
sp|Q03606|YN02_CAEEL CRAL-TRIO domain-containing protein T23G5.2 OS=Caenorhabditis elegans GN=T23G5.2 PE=3 SV=3 69 233 3.0E-10
sp|Q92503|S14L1_HUMAN SEC14-like protein 1 OS=Homo sapiens GN=SEC14L1 PE=1 SV=2 67 240 3.0E-09
sp|Q757H2|CSR1_ASHGO Phosphatidylinositol transfer protein CSR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSR1 PE=3 SV=2 59 233 6.0E-09
sp|Q56ZI2|PATL2_ARATH Patellin-2 OS=Arabidopsis thaliana GN=PATL2 PE=1 SV=2 68 235 1.0E-08
sp|Q9VMD6|RETM_DROME Protein real-time OS=Drosophila melanogaster GN=retm PE=1 SV=2 56 235 2.0E-08
sp|O43304|S14L5_HUMAN SEC14-like protein 5 OS=Homo sapiens GN=SEC14L5 PE=2 SV=3 67 235 6.0E-08
sp|Q9CWP6|MSPD2_MOUSE Motile sperm domain-containing protein 2 OS=Mus musculus GN=Mospd2 PE=1 SV=2 49 228 7.0E-08
sp|Q29JQ0|RETM_DROPS Protein real-time OS=Drosophila pseudoobscura pseudoobscura GN=retm PE=3 SV=1 56 235 2.0E-07
sp|Q0V9N0|S14L5_XENTR SEC14-like protein 5 OS=Xenopus tropicalis GN=sec14l1 PE=2 SV=1 67 235 1.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1032
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3109
Ophiocordyceps australis 1348a (Ghana) OphauG2|5400 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1868
Ophiocordyceps camponoti-floridani Ophcf2|03502
Ophiocordyceps camponoti-rufipedis Ophun1|5552
Ophiocordyceps kimflemingae Ophio5|7541
Ophiocordyceps subramaniannii Hirsu2|9464

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5400
MAPRKTPIATPPAESKPQAAAALTKEQETKYSTLLQRMRALTTVTCDKEASKSGPVSDSERLWLTRECLLRYLRA
TRWAVDEAAKRLHSTLGWRREYGLDGFTADYISPEQETGKQFILGYDRHGRPCQYLVPGRQNTHQSARQIHHMFY
MTERVMDVMPPGVESLCLMIDFKPSKTKYNSTVSVSVAREVLHILQNHYPERLGKALIINVPWIVWGFFKLINPF
IDPVTRDKRLGRAARV*
Coding >OphauG2|5400
ATGGCTCCGCGAAAAACACCCATCGCAACTCCGCCGGCCGAGAGCAAACCGCAGGCGGCGGCCGCCCTGACCAAG
GAGCAAGAGACCAAATACTCGACACTCCTGCAACGCATGCGGGCCCTCACGACAGTGACGTGCGACAAGGAGGCG
AGCAAATCAGGCCCGGTCAGCGACAGCGAGCGGCTGTGGCTCACGCGCGAGTGTCTGCTGCGCTATCTGCGCGCG
ACGCGGTGGGCCGTGGACGAGGCGGCCAAGCGGCTGCACAGCACGCTCGGGTGGCGGCGCGAGTACGGGCTCGAC
GGCTTCACGGCCGACTACATCTCGCCGGAGCAGGAGACGGGCAAGCAGTTTATCCTGGGCTATGACCGGCATGGG
CGGCCGTGCCAGTACTTGGTTCCCGGGCGGCAGAACACGCACCAGAGCGCGCGGCAGATCCATCACATGTTTTAC
ATGACGGAGCGGGTCATGGATGTGATGCCGCCGGGCGTGGAGTCGCTGTGCCTCATGATTGATTTTAAGCCGTCA
AAGACAAAGTACAACTCGACCGTGTCGGTGTCGGTGGCGCGCGAGGTGTTGCATATTCTGCAGAATCATTATCCG
GAGCGGCTGGGCAAGGCTCTGATAATCAATGTGCCCTGGATTGTCTGGGGCTTCTTCAAGCTCATCAACCCCTTC
ATCGACCCCGTGACGCGCGACAAGCGACTGGGGCGGGCGGCTCGAGTTTGA
Transcript >OphauG2|5400
ATGGCTCCGCGAAAAACACCCATCGCAACTCCGCCGGCCGAGAGCAAACCGCAGGCGGCGGCCGCCCTGACCAAG
GAGCAAGAGACCAAATACTCGACACTCCTGCAACGCATGCGGGCCCTCACGACAGTGACGTGCGACAAGGAGGCG
AGCAAATCAGGCCCGGTCAGCGACAGCGAGCGGCTGTGGCTCACGCGCGAGTGTCTGCTGCGCTATCTGCGCGCG
ACGCGGTGGGCCGTGGACGAGGCGGCCAAGCGGCTGCACAGCACGCTCGGGTGGCGGCGCGAGTACGGGCTCGAC
GGCTTCACGGCCGACTACATCTCGCCGGAGCAGGAGACGGGCAAGCAGTTTATCCTGGGCTATGACCGGCATGGG
CGGCCGTGCCAGTACTTGGTTCCCGGGCGGCAGAACACGCACCAGAGCGCGCGGCAGATCCATCACATGTTTTAC
ATGACGGAGCGGGTCATGGATGTGATGCCGCCGGGCGTGGAGTCGCTGTGCCTCATGATTGATTTTAAGCCGTCA
AAGACAAAGTACAACTCGACCGTGTCGGTGTCGGTGGCGCGCGAGGTGTTGCATATTCTGCAGAATCATTATCCG
GAGCGGCTGGGCAAGGCTCTGATAATCAATGTGCCCTGGATTGTCTGGGGCTTCTTCAAGCTCATCAACCCCTTC
ATCGACCCCGTGACGCGCGACAAGCGACTGGGGCGGGCGGCTCGAGTTTGA
Gene >OphauG2|5400
ATGGCTCCGCGAAAAACACCCATCGCAACTCCGCCGGCCGAGAGCAAACCGCAGGCGGCGGCCGCCCTGACCAAG
GAGCAAGAGACCAAATACTCGACACTCCTGCAACGCATGCGGGCCCTCACGACAGTGACGTGCGACAAGGAGGCG
AGCAAATCAGGCCCGGTCAGCGACAGCGAGCGGCTGTGGCTCACGCGCGAGTGTCTGCTGCGCTATCTGCGCGCG
ACGCGGTGGGCCGTGGACGAGGCGGCCAAGCGGCTGCACAGCACGCTCGGGTGGCGGCGCGAGTACGGGCTCGAC
GGCTTCACGGCCGACTACATCTCGCCGGAGCAGGAGACGGGCAAGCAGTTTATCCTGGGCTATGACCGGCATGGG
CGGCCGTGCCAGTACTTGGTTCCCGGGCGGCAGAACACGCACCAGAGCGCGCGGCAGATCCATCACATGTTTTAC
ATGACGGAGCGGGTCATGGATGTGATGCCGCCGGGCGTGGAGTCGCTGTGCCTCATGATTGATTTTAAGCCGTCA
AAGACAAAGTACAACTCGACCGTGTCGGTGTCGGTGGCGCGCGAGGTGTTGCATATTCTGCAGAATCATTATCCG
GAGCGGCTGGGCAAGGCTCTGATAATCAATGGTGCGTTTTTTTTTTCCTTTTTTTCTTCTTTTTTTCCCCCTATT
TTTCTTCTTTTTTCCCCCCTTTTTTTCTATTTTTTTTTCTTTCCCCTAACGCTTGTTCTAGTGCCCTGGATTGTC
TGGGGCTTCTTCAAGCTCATCAACCCCTTCATCGACCCCGTGACGCGCGACAAGGTAAAGTTCAACGGCGACATG
ACGCAGTATGTTGCGCCCGACCAGCTGTGGCGCAGCGACTGGGGCGGGCGGCTCGAGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail