Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5393
Gene name
LocationContig_496:7319..10083
Strand-
Gene length (bp)2764
Transcript length (bp)2487
Coding sequence length (bp)2487
Protein length (aa) 829

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03097 BRO1 BRO1-like domain 6.4E-109 9 388
PF13949 ALIX_LYPXL_bnd ALIX V-shaped domain binding to HIV 8.5E-81 424 731

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q51NJ3|PALA_MAGO7 pH-response regulator protein palA/RIM20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RIM20 PE=3 SV=1 1 828 0.0E+00
sp|Q7S532|PALA_NEUCR pH-response regulator protein palA/prr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prr-1 PE=3 SV=2 4 828 0.0E+00
sp|Q5KU05|PALA_ASPOR pH-response regulator protein palA/RIM20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=palA PE=3 SV=2 5 828 0.0E+00
sp|P79020|PALA_EMENI pH-response regulator protein palA/RIM20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=palA PE=1 SV=3 8 828 0.0E+00
sp|Q8WZL4|PALA_YARLI pH-response regulator protein RIM20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RIM20 PE=3 SV=2 8 805 2.0E-130
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q51NJ3|PALA_MAGO7 pH-response regulator protein palA/RIM20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RIM20 PE=3 SV=1 1 828 0.0E+00
sp|Q7S532|PALA_NEUCR pH-response regulator protein palA/prr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prr-1 PE=3 SV=2 4 828 0.0E+00
sp|Q5KU05|PALA_ASPOR pH-response regulator protein palA/RIM20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=palA PE=3 SV=2 5 828 0.0E+00
sp|P79020|PALA_EMENI pH-response regulator protein palA/RIM20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=palA PE=1 SV=3 8 828 0.0E+00
sp|Q8WZL4|PALA_YARLI pH-response regulator protein RIM20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RIM20 PE=3 SV=2 8 805 2.0E-130
sp|P0CM46|PALA_CRYNJ pH-response regulator protein palA/RIM20 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RIM20 PE=3 SV=1 20 731 1.0E-109
sp|P0CM47|PALA_CRYNB pH-response regulator protein palA/RIM20 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RIM20 PE=3 SV=1 20 731 1.0E-109
sp|Q6BLT2|PALA_DEBHA pH-response regulator protein palA/RIM20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RIM20 PE=3 SV=2 8 805 1.0E-98
sp|Q9UW12|PALA_CANAL pH-response regulator protein palA/RIM20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RIM20 PE=3 SV=2 8 805 3.0E-88
sp|Q9W6C5|PDC6I_XENLA Programmed cell death 6-interacting protein OS=Xenopus laevis GN=pdcd6ip PE=1 SV=1 9 713 4.0E-52
sp|Q8T7K0|ALIX_DICDI ALG-2 interacting protein X OS=Dictyostelium discoideum GN=alxA PE=1 SV=1 8 739 4.0E-51
sp|Q9WU78|PDC6I_MOUSE Programmed cell death 6-interacting protein OS=Mus musculus GN=Pdcd6ip PE=1 SV=3 13 713 8.0E-49
sp|Q9QZA2|PDC6I_RAT Programmed cell death 6-interacting protein OS=Rattus norvegicus GN=Pdcd6ip PE=1 SV=2 13 713 2.0E-47
sp|Q8WUM4|PDC6I_HUMAN Programmed cell death 6-interacting protein OS=Homo sapiens GN=PDCD6IP PE=1 SV=1 9 713 6.0E-47
sp|P34552|ALXA_CAEEL Apoptosis-linked gene 2-interacting protein X 1 OS=Caenorhabditis elegans GN=alx-1 PE=2 SV=3 9 745 7.0E-45
sp|Q12033|PALA_YEAST pH-response regulator protein palA/RIM20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM20 PE=1 SV=1 8 733 5.0E-44
sp|Q4IBS9|BRO1_GIBZE Vacuolar protein-sorting protein BRO1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=BRO1 PE=3 SV=1 8 745 5.0E-40
sp|Q4X0Z5|BRO1_ASPFU Vacuolar protein-sorting protein bro1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bro1 PE=3 SV=1 8 735 4.0E-38
sp|C8V212|BRO1_EMENI Vacuolar protein-sorting protein bro1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=broA PE=3 SV=1 8 494 5.0E-37
sp|Q9H3S7|PTN23_HUMAN Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens GN=PTPN23 PE=1 SV=1 25 714 2.0E-36
sp|Q6PB44|PTN23_MOUSE Tyrosine-protein phosphatase non-receptor type 23 OS=Mus musculus GN=Ptpn23 PE=1 SV=2 23 714 4.0E-36
sp|Q6CU63|PALA_KLULA pH-response regulator protein palA/RIM20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RIM20 PE=3 SV=1 8 739 5.0E-36
sp|Q7SAN9|BRO1_NEUCR Vacuolar protein-sorting protein bro-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bro-1 PE=3 SV=1 8 752 2.0E-34
sp|P0CM44|BRO1_CRYNJ Vacuolar protein-sorting protein BRO1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=BRO1 PE=3 SV=1 1 810 7.0E-34
sp|P0CM45|BRO1_CRYNB Vacuolar protein-sorting protein BRO1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=BRO1 PE=3 SV=1 1 810 9.0E-32
sp|Q756C5|PALA_ASHGO pH-response regulator protein palA/RIM20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RIM20 PE=3 SV=1 10 386 1.0E-30
sp|O13783|BRO1_SCHPO Vacuolar protein-sorting protein bro1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bro1 PE=3 SV=1 9 667 3.0E-23
sp|Q6CGJ5|BRO1_YARLI Vacuolar protein-sorting protein BRO1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BRO1 PE=3 SV=1 8 735 3.0E-22
sp|Q4PHA8|BRO1_USTMA Vacuolar protein-sorting protein BRO1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=BRO1 PE=3 SV=1 14 417 2.0E-21
sp|Q63ZR5|RHN2B_XENLA Rhophilin-2-B OS=Xenopus laevis GN=rhpn2-b PE=2 SV=1 8 255 1.0E-18
sp|O88902|PTN23_RAT Tyrosine-protein phosphatase non-receptor type 23 (Fragment) OS=Rattus norvegicus GN=Ptpn23 PE=1 SV=2 184 714 1.0E-18
sp|Q8HXG3|RHPN2_CANLF Rhophilin-2 OS=Canis lupus familiaris GN=RHPN2 PE=2 SV=1 3 256 1.0E-17
sp|A4FUC9|RHPN2_BOVIN Rhophilin-2 OS=Bos taurus GN=RHPN2 PE=2 SV=1 8 256 7.0E-17
sp|Q8IUC4|RHPN2_HUMAN Rhophilin-2 OS=Homo sapiens GN=RHPN2 PE=1 SV=1 3 255 7.0E-17
sp|Q5AJC1|BRO1_CANAL Vacuolar protein-sorting protein BRO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BRO1 PE=3 SV=1 8 709 1.0E-16
sp|Q6DJJ6|RHN2A_XENLA Rhophilin-2-A OS=Xenopus laevis GN=rhpn2-a PE=2 SV=1 8 255 1.0E-16
sp|Q8BWR8|RHPN2_MOUSE Rhophilin-2 OS=Mus musculus GN=Rhpn2 PE=1 SV=2 3 256 7.0E-15
sp|Q74ZJ6|BRO1_ASHGO Vacuolar protein-sorting protein BRO1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BRO1 PE=3 SV=2 8 732 1.0E-14
sp|Q61085|RHPN1_MOUSE Rhophilin-1 OS=Mus musculus GN=Rhpn1 PE=1 SV=2 8 270 1.0E-14
sp|Q09807|PALA_SCHPO pH-response regulator protein palA/rim20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rim20 PE=3 SV=1 40 347 2.0E-13
sp|Q6TNR1|RHPN2_DANRE Rhophilin-2 OS=Danio rerio GN=rhpn2 PE=2 SV=1 8 250 5.0E-13
sp|Q8TCX5|RHPN1_HUMAN Rhophilin-1 OS=Homo sapiens GN=RHPN1 PE=1 SV=1 3 192 7.0E-13
sp|Q6CM12|BRO1_KLULA Vacuolar protein-sorting protein BRO1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=BRO1 PE=3 SV=1 7 420 3.0E-12
sp|Q6FJG8|BRO1_CANGA Vacuolar protein-sorting protein BRO1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=BRO1 PE=3 SV=1 70 421 2.0E-11
sp|A8MT19|RHN2P_HUMAN Putative rhophilin-2-like protein RHPN2P1 OS=Homo sapiens GN=RHPN2P1 PE=5 SV=2 3 255 4.0E-08
sp|P48582|BRO1_YEAST Vacuolar-sorting protein BRO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRO1 PE=1 SV=2 47 421 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5393
MSATTDLVLGLPFRRSKHISLASTIRPYINAKYDQHPDMFKQDLEAIDALRRDAVNSCEPHPSHIRALQAYAGQL
TWIGGKFPIDIGAEFTWYPALGYNTERPMVRNNVKFDLINILYNLAALYSQLGANGPRTHAEGLKQAAHNFNLAA
GVLLYIQNQVLPELRIADPPDDMDMDTLEALKQLLLAQSQECSWYIGVVNGLRDISIAKLAVRVSDLYNLAAEAA
VKSEAISSAWIHHMTAKHHHFAAAAQFRAASDCLEKKKYGEEVARLKDAVVCVNEGLKATRGGFLHRQIAGDLNT
LKKKAEEDLKRAEKDNDMIFLNAVPPKSELKILDRFNMAEAKIPPQVAKPLDYLGAKAELGPPLFSKLVPFSVHL
AISIYDERRDRLLHQNIMHELEQLTAKGQAAVSSIGLPGSLQALEKPLGLPPSLVQHAEELRQGDAIGRVHKSLG
DIDKLRAADLAMYEEAKAALAAEREEDDRLRSKYGTERWTRPDSYHEPQGAKLWTDAEAIAGYFASSSTSDATVR
EKFASSEELLRILCGPDRGLMEFVPSSVAHETNEELKASVGKLRSAYNDMLRLESRRRKKIESLGQGSQRDDIKP
EILKEAARLERTYPSTAIVPAHFEEFFERRLDRLYEPELEAIEKETQEQQKILAAIHRANREFEAQKRRVTDAGV
REREEALQRLDKAYYKYKEVVNNLEVGRKFYNDLHRIVGPSFRDVVKVWVSKRQLEARALEEELSMPRLSRLSLT
AAGSEAAHGAAGYGAAEARMPMEAAAVQSWADEELQQPQPQAGGVWQPGMGIKFGGGSGDGQEQKTGTWTPSTGI
KFG*
Coding >OphauG2|5393
ATGTCGGCAACGACAGATTTGGTGCTCGGATTGCCTTTTCGCAGATCAAAGCACATTTCGCTTGCGTCGACGATC
CGGCCATACATCAATGCCAAGTATGACCAGCATCCCGACATGTTCAAGCAGGATCTGGAGGCGATTGATGCGCTG
CGCCGGGATGCTGTCAATTCTTGCGAGCCTCATCCAAGCCACATCAGAGCGCTCCAGGCATATGCAGGGCAGCTG
ACGTGGATTGGGGGCAAATTCCCCATTGATATTGGAGCCGAATTTACTTGGTATCCGGCTCTCGGATACAACACG
GAGCGGCCCATGGTGCGAAACAATGTCAAATTCGACCTCATCAACATACTCTACAATCTCGCCGCCCTCTACTCA
CAACTCGGGGCCAATGGTCCGCGCACGCATGCTGAAGGCCTTAAGCAAGCTGCACACAACTTCAACCTGGCCGCG
GGCGTCTTGCTGTACATCCAGAACCAGGTGCTGCCCGAATTGCGCATTGCTGACCCTCCGGATGACATGGACATG
GACACTCTCGAGGCACTCAAGCAACTATTGCTGGCCCAGAGCCAAGAGTGTTCCTGGTATATTGGTGTCGTCAAC
GGACTCAGGGATATCAGCATAGCAAAGTTGGCGGTTCGTGTGTCGGACCTCTACAATTTGGCCGCCGAGGCGGCA
GTCAAGAGCGAGGCCATAAGCAGTGCCTGGATACATCACATGACGGCAAAGCACCATCATTTCGCCGCAGCTGCA
CAGTTTCGCGCTGCCAGTGATTGTCTGGAGAAGAAGAAGTACGGCGAAGAGGTGGCCCGGCTAAAGGATGCTGTT
GTCTGTGTAAACGAGGGACTCAAGGCCACTCGAGGGGGCTTCCTGCACAGGCAGATAGCTGGTGACCTCAACACT
CTGAAAAAGAAGGCCGAAGAGGACCTTAAGCGCGCAGAAAAGGACAACGACATGATATTCCTAAACGCTGTTCCG
CCAAAGTCGGAGCTCAAGATTCTCGACCGCTTCAACATGGCCGAGGCCAAAATACCGCCGCAAGTAGCCAAACCG
CTCGATTATTTGGGGGCCAAGGCAGAATTGGGGCCTCCTCTATTCTCCAAACTGGTTCCCTTTTCTGTGCATTTG
GCCATTTCAATCTATGACGAGCGCAGAGACCGCTTGCTTCACCAAAACATCATGCATGAACTGGAGCAACTGACA
GCAAAGGGTCAGGCTGCAGTTTCATCTATTGGGTTGCCGGGATCCTTGCAGGCCCTGGAGAAGCCTCTTGGCCTC
CCGCCCAGTCTCGTGCAGCACGCCGAGGAGCTGAGGCAAGGCGACGCGATTGGCAGGGTGCACAAGAGCCTTGGT
GACATTGACAAGCTTCGAGCGGCCGATTTGGCCATGTATGAGGAAGCAAAGGCAGCGCTGGCAGCGGAGCGTGAA
GAAGACGATCGATTAAGAAGCAAGTACGGGACCGAGCGGTGGACACGGCCTGACAGCTACCACGAGCCCCAGGGG
GCCAAGCTGTGGACAGATGCCGAGGCGATTGCGGGATACTTTGCCAGCAGCAGCACAAGCGACGCCACAGTCAGG
GAAAAGTTTGCTTCCAGCGAGGAGCTTTTGCGCATCTTGTGCGGACCAGACCGGGGGCTGATGGAGTTTGTACCT
TCGAGCGTGGCGCACGAGACCAATGAAGAACTCAAGGCATCGGTTGGCAAGCTCCGCAGCGCCTACAACGATATG
CTTCGGCTAGAGAGCAGGCGGCGCAAAAAGATTGAAAGCCTGGGCCAAGGGTCGCAGCGCGACGACATCAAGCCC
GAGATCCTCAAGGAGGCCGCAAGGCTTGAACGCACGTATCCGTCGACGGCCATTGTGCCGGCCCACTTTGAGGAG
TTTTTCGAGAGGCGGCTGGACCGGCTGTATGAGCCAGAGCTGGAGGCGATTGAGAAGGAGACGCAAGAGCAGCAA
AAGATTTTGGCCGCGATTCACCGAGCAAACCGCGAGTTTGAGGCACAGAAGCGCAGAGTGACGGATGCCGGGGTT
CGCGAGCGCGAGGAGGCTCTGCAGAGACTGGACAAGGCGTATTACAAGTACAAGGAGGTGGTGAACAACCTCGAG
GTGGGCCGCAAGTTTTACAATGACTTGCACCGAATCGTCGGGCCGTCATTCCGCGATGTGGTCAAGGTATGGGTC
AGCAAGCGGCAGCTTGAGGCGCGGGCGCTTGAGGAAGAGCTGAGCATGCCGCGACTCTCACGGCTGAGCTTGACG
GCTGCGGGAAGCGAGGCGGCGCACGGGGCGGCAGGATACGGGGCGGCAGAGGCGCGAATGCCCATGGAAGCGGCG
GCGGTGCAGTCGTGGGCAGACGAGGAGCTGCAGCAGCCGCAGCCGCAAGCGGGCGGAGTGTGGCAGCCAGGCATG
GGCATCAAGTTTGGAGGCGGCTCGGGCGACGGACAGGAACAAAAGACGGGCACGTGGACGCCGAGCACAGGAATC
AAATTTGGGTGA
Transcript >OphauG2|5393
ATGTCGGCAACGACAGATTTGGTGCTCGGATTGCCTTTTCGCAGATCAAAGCACATTTCGCTTGCGTCGACGATC
CGGCCATACATCAATGCCAAGTATGACCAGCATCCCGACATGTTCAAGCAGGATCTGGAGGCGATTGATGCGCTG
CGCCGGGATGCTGTCAATTCTTGCGAGCCTCATCCAAGCCACATCAGAGCGCTCCAGGCATATGCAGGGCAGCTG
ACGTGGATTGGGGGCAAATTCCCCATTGATATTGGAGCCGAATTTACTTGGTATCCGGCTCTCGGATACAACACG
GAGCGGCCCATGGTGCGAAACAATGTCAAATTCGACCTCATCAACATACTCTACAATCTCGCCGCCCTCTACTCA
CAACTCGGGGCCAATGGTCCGCGCACGCATGCTGAAGGCCTTAAGCAAGCTGCACACAACTTCAACCTGGCCGCG
GGCGTCTTGCTGTACATCCAGAACCAGGTGCTGCCCGAATTGCGCATTGCTGACCCTCCGGATGACATGGACATG
GACACTCTCGAGGCACTCAAGCAACTATTGCTGGCCCAGAGCCAAGAGTGTTCCTGGTATATTGGTGTCGTCAAC
GGACTCAGGGATATCAGCATAGCAAAGTTGGCGGTTCGTGTGTCGGACCTCTACAATTTGGCCGCCGAGGCGGCA
GTCAAGAGCGAGGCCATAAGCAGTGCCTGGATACATCACATGACGGCAAAGCACCATCATTTCGCCGCAGCTGCA
CAGTTTCGCGCTGCCAGTGATTGTCTGGAGAAGAAGAAGTACGGCGAAGAGGTGGCCCGGCTAAAGGATGCTGTT
GTCTGTGTAAACGAGGGACTCAAGGCCACTCGAGGGGGCTTCCTGCACAGGCAGATAGCTGGTGACCTCAACACT
CTGAAAAAGAAGGCCGAAGAGGACCTTAAGCGCGCAGAAAAGGACAACGACATGATATTCCTAAACGCTGTTCCG
CCAAAGTCGGAGCTCAAGATTCTCGACCGCTTCAACATGGCCGAGGCCAAAATACCGCCGCAAGTAGCCAAACCG
CTCGATTATTTGGGGGCCAAGGCAGAATTGGGGCCTCCTCTATTCTCCAAACTGGTTCCCTTTTCTGTGCATTTG
GCCATTTCAATCTATGACGAGCGCAGAGACCGCTTGCTTCACCAAAACATCATGCATGAACTGGAGCAACTGACA
GCAAAGGGTCAGGCTGCAGTTTCATCTATTGGGTTGCCGGGATCCTTGCAGGCCCTGGAGAAGCCTCTTGGCCTC
CCGCCCAGTCTCGTGCAGCACGCCGAGGAGCTGAGGCAAGGCGACGCGATTGGCAGGGTGCACAAGAGCCTTGGT
GACATTGACAAGCTTCGAGCGGCCGATTTGGCCATGTATGAGGAAGCAAAGGCAGCGCTGGCAGCGGAGCGTGAA
GAAGACGATCGATTAAGAAGCAAGTACGGGACCGAGCGGTGGACACGGCCTGACAGCTACCACGAGCCCCAGGGG
GCCAAGCTGTGGACAGATGCCGAGGCGATTGCGGGATACTTTGCCAGCAGCAGCACAAGCGACGCCACAGTCAGG
GAAAAGTTTGCTTCCAGCGAGGAGCTTTTGCGCATCTTGTGCGGACCAGACCGGGGGCTGATGGAGTTTGTACCT
TCGAGCGTGGCGCACGAGACCAATGAAGAACTCAAGGCATCGGTTGGCAAGCTCCGCAGCGCCTACAACGATATG
CTTCGGCTAGAGAGCAGGCGGCGCAAAAAGATTGAAAGCCTGGGCCAAGGGTCGCAGCGCGACGACATCAAGCCC
GAGATCCTCAAGGAGGCCGCAAGGCTTGAACGCACGTATCCGTCGACGGCCATTGTGCCGGCCCACTTTGAGGAG
TTTTTCGAGAGGCGGCTGGACCGGCTGTATGAGCCAGAGCTGGAGGCGATTGAGAAGGAGACGCAAGAGCAGCAA
AAGATTTTGGCCGCGATTCACCGAGCAAACCGCGAGTTTGAGGCACAGAAGCGCAGAGTGACGGATGCCGGGGTT
CGCGAGCGCGAGGAGGCTCTGCAGAGACTGGACAAGGCGTATTACAAGTACAAGGAGGTGGTGAACAACCTCGAG
GTGGGCCGCAAGTTTTACAATGACTTGCACCGAATCGTCGGGCCGTCATTCCGCGATGTGGTCAAGGTATGGGTC
AGCAAGCGGCAGCTTGAGGCGCGGGCGCTTGAGGAAGAGCTGAGCATGCCGCGACTCTCACGGCTGAGCTTGACG
GCTGCGGGAAGCGAGGCGGCGCACGGGGCGGCAGGATACGGGGCGGCAGAGGCGCGAATGCCCATGGAAGCGGCG
GCGGTGCAGTCGTGGGCAGACGAGGAGCTGCAGCAGCCGCAGCCGCAAGCGGGCGGAGTGTGGCAGCCAGGCATG
GGCATCAAGTTTGGAGGCGGCTCGGGCGACGGACAGGAACAAAAGACGGGCACGTGGACGCCGAGCACAGGAATC
AAATTTGGGTGA
Gene >OphauG2|5393
ATGTCGGCAACGTATGTATTTGGCCATGTGAAACAGAATAGGCTCGACTAAGATGCAGGGCTCAGGACAGATTTG
GTGCTCGGATTGCCTTTTCGCAGATCAAAGCACATTTCGCTTGCGTCGACGATCCGGCCATACATCAATGCCAAG
TATGACCAGCATCCCGACATGTTCAAGCAGGATCTGGAGGCGATTGATGCGCTGCGCCGGGATGCTGTCAATTCT
TGCGAGCCTCATCCAAGCCACATCAGAGCGCTCCAGGCATATGCAGGGCAGCTGACGTGGATTGGGGGCAAATTC
CCCATTGATGTGTGTGCTTCTCCAGCGAGTTGCTTGCGTCTTGATTGCGGCCCCTGACTTGTCAATGACGGGCAG
ATTGGAGCCGAATTTACTTGGTATCCGGCTCTCGGATACAACACGGAGCGGCCCATGGTGCGAAACAATGTCAAA
TTCGACCTCATCAACATACTCTACAATCTCGCCGCCCTCTACTCACAACTCGGGGCCAATGGTCCGCGCACGCAT
GCTGAAGGCCTTAAGCAAGCTGCACACAACTTCAACCTGGCCGCGGGCGTCTTGCTGTACATCCAGAACCAGGTG
CTGCCCGAATTGCGCATTGCTGACCCTCCGGATGACATGGACATGGACACTCTCGAGGCACTCAAGCAACTATTG
CTGGCCCAGAGCCAAGAGTGTTCCTGGTATATTGGTGTCGTCAACGGACTCAGGGATATCAGCATAGCAAAGTTG
GCGGTTCGTGTGTCGGACCTCTACAATTTGGCCGCCGAGGCGGCAGTCAAGAGCGAGGCCATAAGCAGTGCCTGG
ATACATCACATGACGGCAAAGCACCATCATTTCGCCGCAGCTGCACAGTTTCGCGCTGCCAGTGATTGTCTGGAG
AAGAAGAAGTACGGCGAAGAGGTGGCCCGGCTAAAGGATGCTGTTGTCTGTGTAAACGAGGGACTCAAGGCCACT
CGAGGGGGCTTCCTGCACAGGCAGATAGCTGGTGACCTCAACACTCTGAAAAAGAAGGCCGAAGAGGACCTTAAG
CGCGCAGAAAAGGACAACGACATGATATTCCTAAGTGCGTCAAAGGCCTAGAAAAAAAGGCACTATTATTTGACC
TGTGCATTGCTAACAATAATTCATGGACGAATAGACGCTGTTCCGCCAAAGTCGGAGCTCAAGATTCTCGACCGC
TTCAACATGGCCGAGGCCAAAATACCGCCGCAAGTAGCCAAACCGCTCGATTATTTGGGGGCCAAGGCAGAATTG
GGGCCTCCTCTATTCTCCAAACTGGTTCCCTTTTCTGTGCATTTGGCCATTTCAATCTATGACGAGCGCAGAGAC
CGCTTGCTTCACCAAAACATCATGCATGAACTGGAGCAACTGACAGCAAAGGGTCAGGCTGCAGTTTCATCTATT
GGGTTGCCGGGATCCTTGCAGGCCCTGGAGAAGCCTCTTGGCCTCCCGCCCAGTCTCGTGCAGCACGCCGAGGAG
CTGAGGCAAGGCGACGCGATTGGCAGGGTGCACAAGAGCCTTGGTGACATTGACAAGCTTCGAGCGGCCGATTTG
GCCATGTATGAGGAAGCAAAGGCAGCGCTGGCAGCGGAGCGTGAAGAAGACGATCGATTAAGAAGCAAGTACGGG
ACCGAGCGGTGGACACGGCCTGACAGCTACCACGAGCCCCAGGGGGCCAAGCTGTGGACAGATGCCGAGGCGATT
GCGGGATACTTTGCCAGCAGCAGCACAAGCGACGCCACAGTCAGGGAAAAGTTTGCTTCCAGCGAGGAGCTTTTG
CGCATCTTGTGCGGACCAGACCGGGGGCTGATGGAGTTTGTACCTTCGAGCGTGGCGCACGAGACCAATGAAGAA
CTCAAGGCATCGGTTGGCAAGCTCCGCAGCGCCTACAACGATATGCTTCGGCTAGAGAGCAGGCGGCGCAAAAAG
ATTGAAAGCCTGGGCCAAGGGTCGCAGCGCGACGACATCAAGCCCGAGATCCTCAAGGAGGCCGCAAGGCTTGAA
CGCACGTATCCGTCGACGGCCATTGTGCCGGCCCACTTTGAGGAGTTTTTCGAGAGGCGGCTGGACCGGCTGTAT
GAGCCAGAGCTGGAGGCGATTGAGAAGGAGACGCAAGAGCAGCAAAAGATTTTGGCCGCGATTCACCGAGCAAAC
CGCGAGTTTGAGGCACAGAAGCGCAGAGTGACGGATGCCGGGGTTCGCGAGCGCGAGGAGGCTCTGCAGAGACTG
GACAAGGCGTATTACAAGTACAAGGAGGTGGTGAACAACCTCGAGGTGGGCCGCAAGTTTTACAATGACTTGCAC
CGAATCGTCGGGCCGTCATTCCGCGATGTGGTCAAGGTATGGGTCAGCAAGCGGCAGCTTGAGGCGCGGGCGCTT
GAGGAGTAAGTGGGCGGCAAAAAAAAAAAAAAAGGCTGCGTTTTTAATGCTCTGAGTAAGGCTTGGGGCTGGCTA
ACAGTGTTACAGAGAGCTGAGCATGCCGCGACTCTCACGGCTGAGCTTGACGGCTGCGGGAAGCGAGGCGGCGCA
CGGGGCGGCAGGATACGGGGCGGCAGAGGCGCGAATGCCCATGGAAGCGGCGGCGGTGCAGTCGTGGGCAGACGA
GGAGCTGCAGCAGCCGCAGCCGCAAGCGGGCGGAGTGTGGCAGCCAGGCATGGGCATCAAGTTTGGAGGCGGCTC
GGGCGACGGACAGGAACAAAAGACGGGCACGTGGACGCCGAGCACAGGAATCAAATTTGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail