Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5391
Gene name
LocationContig_496:538..2165
Strand-
Gene length (bp)1627
Transcript length (bp)1488
Coding sequence length (bp)1488
Protein length (aa) 496

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02917 Pertussis_S1 Pertussis toxin, subunit 1 6.4E-06 60 111

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0003950 NAD+ ADP-ribosyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016763 pentosyltransferase activity No
GO:0016740 transferase activity No
GO:0016757 glycosyltransferase activity No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999157

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup108
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2055
Ophiocordyceps australis 1348a (Ghana) OphauG2|4948
Ophiocordyceps australis 1348a (Ghana) OphauG2|5391 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1787
Ophiocordyceps australis map64 (Brazil) OphauB2|3127
Ophiocordyceps australis map64 (Brazil) OphauB2|3128
Ophiocordyceps australis map64 (Brazil) OphauB2|3183
Ophiocordyceps australis map64 (Brazil) OphauB2|3335
Ophiocordyceps camponoti-floridani Ophcf2|00223
Ophiocordyceps camponoti-rufipedis Ophun1|875
Ophiocordyceps kimflemingae Ophio5|6442
Ophiocordyceps subramaniannii Hirsu2|10638
Ophiocordyceps subramaniannii Hirsu2|2917
Ophiocordyceps subramaniannii Hirsu2|6025

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5391
MRLGRLILVSLVGGVYGIPTRERDASSSLLRRDKPDGRRESIPAEQASKEEVPDGSDVGIFFRGDSRAPEEVFRD
GFRPQGTNMDLQQHLSFAGGSGYVSLSRSLAASRRYAFGRSADGNRQGYVYVVVPEQLPEGYYIPRLFPNDRAVQ
INREFAAAGAIPGGSIAGAYTYENGNADAPTGWLPNQAYGYSESRPYDPSRDWCFANICSLLGNAAQWVCGGNSD
PCVQERNDAFERERAEAGQQGSNQPTSGANDPACDGQGCQEDDENRYLPGSNSLMALIAGCLFSIKGAGPKRSLD
LAGPLVRRQDSCPASVKTWGAANGLDCSYSAKDKAQCSLSPNGPKEGQSSFTKLKIKAKLANSVRAGTDSIIYIR
FGDKPLIQLFDRPSADDAVEHEVDVAKIFGSNQPAMAELQRFSLMQVVVPTINTVFGTADQWELESIGFEAQHSP
STVTLINDQHKAVNQWLGENAKDSDFPRPVWSAELKTEEWHAHVD*
Coding >OphauG2|5391
ATGCGTCTTGGTAGATTGATTCTGGTCTCGCTCGTGGGCGGGGTCTATGGCATTCCTACAAGGGAGAGAGACGCC
TCTTCCTCTCTGCTCCGACGCGACAAACCCGATGGCAGGCGGGAAAGCATACCGGCAGAACAGGCGTCCAAGGAA
GAGGTTCCCGATGGCAGCGACGTGGGCATTTTTTTCCGGGGAGACTCGCGGGCCCCTGAGGAGGTGTTTCGAGAC
GGATTCAGGCCTCAGGGAACCAACATGGACCTCCAGCAGCATCTGAGCTTCGCGGGCGGGTCGGGCTACGTGTCG
CTGTCGCGGTCTCTGGCTGCGTCGAGGCGATATGCCTTTGGGCGGTCTGCCGACGGGAACCGGCAGGGATACGTC
TACGTGGTGGTGCCTGAGCAGCTCCCCGAGGGATACTACATCCCCAGGCTATTTCCCAACGACCGAGCAGTGCAG
ATCAACCGCGAGTTTGCGGCAGCGGGAGCCATTCCTGGCGGCTCGATTGCCGGGGCGTATACTTATGAGAATGGC
AATGCCGATGCGCCAACCGGCTGGCTGCCCAACCAAGCCTATGGCTACAGCGAGAGTCGGCCGTACGACCCGAGC
AGGGACTGGTGTTTTGCCAACATTTGCAGCCTCCTTGGCAACGCGGCGCAATGGGTTTGCGGAGGAAACTCGGAT
CCCTGTGTCCAGGAGCGCAACGACGCCTTTGAGCGAGAGAGAGCAGAGGCAGGCCAGCAAGGCAGCAACCAGCCC
ACCTCGGGCGCCAACGACCCGGCCTGCGACGGCCAAGGGTGCCAGGAAGACGATGAGAACCGCTACCTGCCCGGC
AGCAACTCGCTCATGGCGCTCATCGCCGGCTGTCTCTTCAGCATCAAGGGCGCCGGCCCCAAGCGGTCCCTCGAC
CTGGCAGGCCCTCTTGTGCGCCGCCAGGACTCGTGTCCCGCCTCGGTCAAGACTTGGGGCGCGGCCAACGGGCTC
GACTGCTCCTACAGTGCCAAAGACAAGGCCCAATGCTCCCTGTCGCCAAACGGCCCCAAAGAGGGCCAGAGCAGC
TTCACCAAGCTCAAGATCAAGGCCAAGCTGGCAAACTCTGTACGCGCAGGCACCGACTCCATCATCTACATCCGC
TTTGGCGACAAGCCGCTCATCCAGCTGTTTGACCGCCCCTCGGCCGACGATGCCGTGGAACACGAAGTCGACGTT
GCCAAAATCTTTGGTTCCAACCAGCCGGCCATGGCTGAGCTGCAGCGCTTTTCCCTCATGCAGGTCGTGGTCCCA
ACCATCAACACCGTCTTTGGCACTGCCGACCAATGGGAGCTTGAGAGCATTGGCTTTGAGGCTCAGCACAGCCCG
TCCACTGTGACGCTCATCAATGACCAGCACAAGGCCGTCAACCAGTGGCTAGGCGAGAATGCCAAGGACTCTGAC
TTTCCACGCCCTGTTTGGAGTGCCGAGCTCAAGACTGAGGAGTGGCACGCCCATGTGGATTAG
Transcript >OphauG2|5391
ATGCGTCTTGGTAGATTGATTCTGGTCTCGCTCGTGGGCGGGGTCTATGGCATTCCTACAAGGGAGAGAGACGCC
TCTTCCTCTCTGCTCCGACGCGACAAACCCGATGGCAGGCGGGAAAGCATACCGGCAGAACAGGCGTCCAAGGAA
GAGGTTCCCGATGGCAGCGACGTGGGCATTTTTTTCCGGGGAGACTCGCGGGCCCCTGAGGAGGTGTTTCGAGAC
GGATTCAGGCCTCAGGGAACCAACATGGACCTCCAGCAGCATCTGAGCTTCGCGGGCGGGTCGGGCTACGTGTCG
CTGTCGCGGTCTCTGGCTGCGTCGAGGCGATATGCCTTTGGGCGGTCTGCCGACGGGAACCGGCAGGGATACGTC
TACGTGGTGGTGCCTGAGCAGCTCCCCGAGGGATACTACATCCCCAGGCTATTTCCCAACGACCGAGCAGTGCAG
ATCAACCGCGAGTTTGCGGCAGCGGGAGCCATTCCTGGCGGCTCGATTGCCGGGGCGTATACTTATGAGAATGGC
AATGCCGATGCGCCAACCGGCTGGCTGCCCAACCAAGCCTATGGCTACAGCGAGAGTCGGCCGTACGACCCGAGC
AGGGACTGGTGTTTTGCCAACATTTGCAGCCTCCTTGGCAACGCGGCGCAATGGGTTTGCGGAGGAAACTCGGAT
CCCTGTGTCCAGGAGCGCAACGACGCCTTTGAGCGAGAGAGAGCAGAGGCAGGCCAGCAAGGCAGCAACCAGCCC
ACCTCGGGCGCCAACGACCCGGCCTGCGACGGCCAAGGGTGCCAGGAAGACGATGAGAACCGCTACCTGCCCGGC
AGCAACTCGCTCATGGCGCTCATCGCCGGCTGTCTCTTCAGCATCAAGGGCGCCGGCCCCAAGCGGTCCCTCGAC
CTGGCAGGCCCTCTTGTGCGCCGCCAGGACTCGTGTCCCGCCTCGGTCAAGACTTGGGGCGCGGCCAACGGGCTC
GACTGCTCCTACAGTGCCAAAGACAAGGCCCAATGCTCCCTGTCGCCAAACGGCCCCAAAGAGGGCCAGAGCAGC
TTCACCAAGCTCAAGATCAAGGCCAAGCTGGCAAACTCTGTACGCGCAGGCACCGACTCCATCATCTACATCCGC
TTTGGCGACAAGCCGCTCATCCAGCTGTTTGACCGCCCCTCGGCCGACGATGCCGTGGAACACGAAGTCGACGTT
GCCAAAATCTTTGGTTCCAACCAGCCGGCCATGGCTGAGCTGCAGCGCTTTTCCCTCATGCAGGTCGTGGTCCCA
ACCATCAACACCGTCTTTGGCACTGCCGACCAATGGGAGCTTGAGAGCATTGGCTTTGAGGCTCAGCACAGCCCG
TCCACTGTGACGCTCATCAATGACCAGCACAAGGCCGTCAACCAGTGGCTAGGCGAGAATGCCAAGGACTCTGAC
TTTCCACGCCCTGTTTGGAGTGCCGAGCTCAAGACTGAGGAGTGGCACGCCCATGTGGATTAG
Gene >OphauG2|5391
ATGCGTCTTGGTAGATTGATTCTGGTCTCGCTCGTGGGCGGGGTCTATGGCATTCCTACAAGGGAGAGAGACGCC
TCTTCCTCTCTGCTCCGACGCGACAAACCCGATGGCAGGCGGGAAAGCATACCGGCAGAACAGGCGTCCAAGGAA
GAGGTTCCCGATGGCAGCGACGTGGGCATTTTTTTCCGGGGAGACTCGCGGGCCCCTGAGGAGGTGTTTCGAGAC
GGATTCAGGCCTCAGGGAACCAACATGGACCTCCAGCAGCATCTGAGCTTCGCGGGCGGGTCGGGCTACGTGTCG
CTGTCGCGGTCTCTGGCTGCGTCGAGGCGATATGCCTTTGGGCGGTCTGCCGACGGGAACCGGCAGGGATACGTC
TACGTGGTGGTGCCTGAGCAGCTCCCCGAGGGATACTACATCCCCAGGCTATTTCCCAACGACCGAGCAGTGCAG
ATCAACCGCGAGTTTGCGGCAGCGGGAGCCATTCCTGGCGGCTCGATTGCCGGGGCGTATACTTATGAGAATGGC
AATGCCGATGCGCCAACCGGCTGGCTGCCCAACCAAGCCTATGGCTACAGCGAGAGTCGGCCGTACGACCCGAGC
AGGGACTGGTGTTTTGCCAACATTTGCAGCCTCCTTGGCAACGCGGCGCAATGGGTTTGCGGAGGAAACTCGGAT
CCCTGTGTCCAGGAGCGCAACGACGCCTTTGAGCGAGAGAGAGCAGAGGCAGGCCAGCAAGGCAGGTCCCGCGCG
TCCAGGCCATGGCGAGAGAGAAACACAAGAGAAACACAGCGCTGACAGCTGCTTCTAGAGAGCCCCATCAGCAAC
CAGCCCACCTCGGGCGCCAACGACCCGGCCTGCGACGGCCAAGGGTGCCAGGAAGACGATGAGAACCGCTACCTG
CCCGGCAGCAACTCGCTCATGGCGCTCATCGCCGGCTGTCTCTTCAGCATCAAGGGCGCCGGCCCCAAGCGGTCC
CTCGACCTGGCAGGCCCTCTTGTGCGCCGCCAGGACTCGTGTCCCGCCTCGGTCAAGACTTGGGGCGCGGCCAAC
GGGCTCGACTGCTCCTACAGTGCCAAAGACAAGGCCCAATGCTCCCTGTCGCCAAACGGCCCCAAAGAGGGCCAG
AGCAGCTTCACCAAGCTCAAGATCAAGGCCAAGCTGGCAAACTCTGTACGCGCAGGCACCGACTCCATCATCTAC
ATCCGCTTTGGCGACAAGCCGCTCATCCAGCTGTTTGACCGCCCCTCGGCCGACGATGCCGTGGAACACGAAGTC
GACGTTGCCAAAATCTTTGGTTCCAACCAGCCGGCCATGGCTGAGCTGCAGCGCTTTTCCCTCATGCAGGTCGTG
GTCCCAACCATCAACACCGTCTTTGGCACTGCCGACCAATGGGAGCTTGAGAGTGAGCATTTTAAAAAAAAATAG
GGGCTTCGCTATACTGACTCGTCCTGTCTTTCTAGGCATTGGCTTTGAGGCTCAGCACAGCCCGTCCACTGTGAC
GCTCATCAATGACCAGCACAAGGCCGTCAACCAGTGGCTAGGCGAGAATGCCAAGGACTCTGACTTTCCACGCCC
TGTTTGGAGTGCCGAGCTCAAGACTGAGGAGTGGCACGCCCATGTGGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail