Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5390
Gene name
LocationContig_495:12442..14181
Strand+
Gene length (bp)1739
Transcript length (bp)1587
Coding sequence length (bp)1587
Protein length (aa) 529

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.1E-08 31 81

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14369|SCE3_SCHPO Probable RNA-binding protein sce3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sce3 PE=1 SV=1 12 152 3.0E-16
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 36 91 2.0E-07
sp|Q5XI72|IF4H_RAT Eukaryotic translation initiation factor 4H OS=Rattus norvegicus GN=Eif4h PE=1 SV=1 30 85 6.0E-07
sp|Q9WUK2|IF4H_MOUSE Eukaryotic translation initiation factor 4H OS=Mus musculus GN=Eif4h PE=1 SV=3 30 85 6.0E-07
sp|Q1JPH6|IF4H_BOVIN Eukaryotic translation initiation factor 4H OS=Bos taurus GN=EIF4H PE=2 SV=1 30 85 6.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14369|SCE3_SCHPO Probable RNA-binding protein sce3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sce3 PE=1 SV=1 12 152 3.0E-16
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 36 91 2.0E-07
sp|Q5XI72|IF4H_RAT Eukaryotic translation initiation factor 4H OS=Rattus norvegicus GN=Eif4h PE=1 SV=1 30 85 6.0E-07
sp|Q9WUK2|IF4H_MOUSE Eukaryotic translation initiation factor 4H OS=Mus musculus GN=Eif4h PE=1 SV=3 30 85 6.0E-07
sp|Q1JPH6|IF4H_BOVIN Eukaryotic translation initiation factor 4H OS=Bos taurus GN=EIF4H PE=2 SV=1 30 85 6.0E-07
sp|Q15056|IF4H_HUMAN Eukaryotic translation initiation factor 4H OS=Homo sapiens GN=EIF4H PE=1 SV=5 30 85 6.0E-07
sp|Q5RBR8|IF4H_PONAB Eukaryotic translation initiation factor 4H OS=Pongo abelii GN=EIF4H PE=2 SV=1 30 85 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5390
MSTWQDRGKQSFLMTIYTLIAKLCSRLLEFFGGSDIVSVRIIEDREMQRPKGFGYVEFGNVEALKKALTLDGQSF
QGRVIRIKVADPPRGGDGRGDSNRDLSDWTRKGPLPDIPGRSGRQQSDFGDRRSRDPAAEPRPAREYTWERRGPL
SPLAQPEPASRSREGSRARPGPEGLGERGESHRGNRHAAGAWGEGRQEGSRPPRRENPERIVSAADRDLQWRERM
RPDAPGKSSPPSRDGSEAPPSPSVPTAAPVPAVRPRLNLAKRTVSEAVEASTPSAGPGEAKASPFGAARPIDTAA
KEKEIEEKRLQAIKDKREAEEKAKEEQRLAKQEAAAKAEAEAEKAAKEQAAAKKLAEEKAKAEQQAAAKAAEPEQ
QVTNSGPQKPNGALAAEAKVAQRGRDGYEAREPREPKDQVSNYKSRAAEAGNWRSASNEQRLGRGPSGGGRGGRG
GGGGGRGSRFDNRGPRSNGSPAHHHHHHHQQQAGQQHSQQAAGQTGGGEAASKQANAPDEEGWTTVPNKKGRQNR
ALA*
Coding >OphauG2|5390
ATGTCGACTTGGCAGGATCGAGGCAAGCAAAGCTTTCTCATGACTATATACACGCTTATTGCTAAACTGTGCTCT
AGGCTACTCGAATTCTTTGGCGGAAGCGACATTGTTAGCGTTCGCATTATTGAAGATCGCGAAATGCAACGTCCC
AAGGGCTTTGGTTACGTGGAATTCGGCAACGTCGAAGCACTCAAGAAGGCGCTCACTCTTGATGGCCAGTCCTTC
CAGGGTCGAGTCATTAGAATCAAGGTGGCAGATCCTCCCCGTGGTGGAGACGGCCGAGGTGATTCCAATCGAGAC
TTGAGCGACTGGACTCGCAAGGGACCTCTGCCAGATATCCCAGGAAGAAGCGGACGCCAACAGTCCGACTTTGGT
GACCGTCGCTCTCGGGACCCCGCCGCCGAACCTCGCCCTGCACGCGAATATACATGGGAGCGCCGTGGGCCTCTT
TCACCACTGGCGCAACCAGAGCCCGCATCGCGATCTCGAGAGGGCAGCCGTGCACGCCCTGGCCCCGAAGGTCTT
GGTGAACGAGGCGAATCCCACCGCGGCAACAGACACGCTGCTGGTGCCTGGGGCGAGGGGCGCCAGGAAGGCTCC
CGCCCCCCGCGCCGGGAAAACCCGGAACGTATTGTAAGCGCCGCCGACAGGGATTTGCAATGGAGAGAGCGCATG
CGCCCCGATGCGCCTGGCAAGTCGAGCCCTCCGTCTCGCGACGGCAGCGAAGCTCCGCCATCCCCATCTGTTCCA
ACAGCTGCCCCAGTGCCTGCTGTGCGTCCCCGACTGAACCTGGCGAAGCGAACGGTATCCGAGGCTGTGGAGGCT
TCAACGCCTTCGGCTGGCCCCGGCGAGGCCAAGGCAAGCCCATTTGGCGCAGCTCGCCCCATTGACACGGCTGCC
AAGGAGAAGGAGATTGAAGAGAAGAGACTACAGGCAATCAAGGACAAGCGCGAGGCAGAGGAAAAGGCCAAGGAG
GAGCAGCGTCTAGCCAAGCAGGAAGCTGCGGCCAAGGCTGAAGCCGAAGCGGAAAAGGCGGCCAAGGAGCAGGCA
GCGGCCAAGAAGCTTGCCGAGGAAAAGGCCAAGGCGGAGCAGCAGGCGGCAGCCAAGGCAGCCGAGCCGGAGCAA
CAGGTTACAAATTCTGGGCCGCAGAAGCCCAACGGGGCATTGGCGGCTGAAGCCAAGGTGGCACAGCGAGGACGC
GACGGCTACGAAGCACGCGAGCCACGGGAGCCCAAAGATCAAGTGAGCAACTACAAGTCGAGAGCAGCTGAAGCA
GGCAACTGGAGATCAGCATCCAATGAGCAGCGGCTGGGACGCGGACCATCTGGCGGAGGCAGAGGTGGACGAGGG
GGGGGCGGTGGTGGTCGAGGGTCGCGCTTTGACAACCGCGGTCCACGGTCCAACGGGTCGCCTGCACATCATCAC
CACCATCATCATCAGCAACAGGCAGGACAGCAGCATTCGCAGCAGGCTGCGGGACAAACAGGTGGTGGCGAGGCA
GCAAGCAAGCAGGCGAATGCGCCTGATGAGGAAGGATGGACTACGGTTCCAAACAAGAAGGGACGACAGAACCGC
GCGTTGGCATAG
Transcript >OphauG2|5390
ATGTCGACTTGGCAGGATCGAGGCAAGCAAAGCTTTCTCATGACTATATACACGCTTATTGCTAAACTGTGCTCT
AGGCTACTCGAATTCTTTGGCGGAAGCGACATTGTTAGCGTTCGCATTATTGAAGATCGCGAAATGCAACGTCCC
AAGGGCTTTGGTTACGTGGAATTCGGCAACGTCGAAGCACTCAAGAAGGCGCTCACTCTTGATGGCCAGTCCTTC
CAGGGTCGAGTCATTAGAATCAAGGTGGCAGATCCTCCCCGTGGTGGAGACGGCCGAGGTGATTCCAATCGAGAC
TTGAGCGACTGGACTCGCAAGGGACCTCTGCCAGATATCCCAGGAAGAAGCGGACGCCAACAGTCCGACTTTGGT
GACCGTCGCTCTCGGGACCCCGCCGCCGAACCTCGCCCTGCACGCGAATATACATGGGAGCGCCGTGGGCCTCTT
TCACCACTGGCGCAACCAGAGCCCGCATCGCGATCTCGAGAGGGCAGCCGTGCACGCCCTGGCCCCGAAGGTCTT
GGTGAACGAGGCGAATCCCACCGCGGCAACAGACACGCTGCTGGTGCCTGGGGCGAGGGGCGCCAGGAAGGCTCC
CGCCCCCCGCGCCGGGAAAACCCGGAACGTATTGTAAGCGCCGCCGACAGGGATTTGCAATGGAGAGAGCGCATG
CGCCCCGATGCGCCTGGCAAGTCGAGCCCTCCGTCTCGCGACGGCAGCGAAGCTCCGCCATCCCCATCTGTTCCA
ACAGCTGCCCCAGTGCCTGCTGTGCGTCCCCGACTGAACCTGGCGAAGCGAACGGTATCCGAGGCTGTGGAGGCT
TCAACGCCTTCGGCTGGCCCCGGCGAGGCCAAGGCAAGCCCATTTGGCGCAGCTCGCCCCATTGACACGGCTGCC
AAGGAGAAGGAGATTGAAGAGAAGAGACTACAGGCAATCAAGGACAAGCGCGAGGCAGAGGAAAAGGCCAAGGAG
GAGCAGCGTCTAGCCAAGCAGGAAGCTGCGGCCAAGGCTGAAGCCGAAGCGGAAAAGGCGGCCAAGGAGCAGGCA
GCGGCCAAGAAGCTTGCCGAGGAAAAGGCCAAGGCGGAGCAGCAGGCGGCAGCCAAGGCAGCCGAGCCGGAGCAA
CAGGTTACAAATTCTGGGCCGCAGAAGCCCAACGGGGCATTGGCGGCTGAAGCCAAGGTGGCACAGCGAGGACGC
GACGGCTACGAAGCACGCGAGCCACGGGAGCCCAAAGATCAAGTGAGCAACTACAAGTCGAGAGCAGCTGAAGCA
GGCAACTGGAGATCAGCATCCAATGAGCAGCGGCTGGGACGCGGACCATCTGGCGGAGGCAGAGGTGGACGAGGG
GGGGGCGGTGGTGGTCGAGGGTCGCGCTTTGACAACCGCGGTCCACGGTCCAACGGGTCGCCTGCACATCATCAC
CACCATCATCATCAGCAACAGGCAGGACAGCAGCATTCGCAGCAGGCTGCGGGACAAACAGGTGGTGGCGAGGCA
GCAAGCAAGCAGGCGAATGCGCCTGATGAGGAAGGATGGACTACGGTTCCAAACAAGAAGGGACGACAGAACCGC
GCGTTGGCATAG
Gene >OphauG2|5390
ATGTCGACTTGGCAGGATCGAGGCAAGCAAAGCTTTCTCATGACTATATACACGCTTATTGCTAAACTGTGCTCT
AGGCTACTCGGTTCGCGAGGAGGCGCCCCAGCGGTTGCCCGACAAGCCACCCTACACGGCTCATTTGGGCAATCT
GTCGTATGACGCAACTTCGGAATCCGTAACAGAATTCTTTGGCGGAAGCGACATTGTTAGCGTTCGCATTATTGA
AGATCGCGAAATGCAACGTCCCAAGGGCTTTGGTTACGTGGAATTCGGCAACGTCGAAGCACTCAAGAAGGCGCT
CACTCTTGATGGCCAGTCCTTCCAGGGTCGAGTCATTAGAATCAAGGTGGCAGATCCTCGTACGTTGTTTCCCAG
TCCAACTTGTTCAATATGCGCTTATTCCTGTCATTCTAGCCCGTGGTGGAGACGGCCGAGGTGATTCCAATCGAG
ACTTGAGCGACTGGACTCGCAAGGGACCTCTGCCAGATATCCCAGGAAGAAGCGGACGCCAACAGTCCGACTTTG
GTGACCGTCGCTCTCGGGACCCCGCCGCCGAACCTCGCCCTGCACGCGAATATACATGGGAGCGCCGTGGGCCTC
TTTCACCACTGGCGCAACCAGAGCCCGCATCGCGATCTCGAGAGGGCAGCCGTGCACGCCCTGGCCCCGAAGGTC
TTGGTGAACGAGGCGAATCCCACCGCGGCAACAGACACGCTGCTGGTGCCTGGGGCGAGGGGCGCCAGGAAGGCT
CCCGCCCCCCGCGCCGGGAAAACCCGGAACGTATTGTAAGCGCCGCCGACAGGGATTTGCAATGGAGAGAGCGCA
TGCGCCCCGATGCGCCTGGCAAGTCGAGCCCTCCGTCTCGCGACGGCAGCGAAGCTCCGCCATCCCCATCTGTTC
CAACAGCTGCCCCAGTGCCTGCTGTGCGTCCCCGACTGAACCTGGCGAAGCGAACGGTATCCGAGGCTGTGGAGG
CTTCAACGCCTTCGGCTGGCCCCGGCGAGGCCAAGGCAAGCCCATTTGGCGCAGCTCGCCCCATTGACACGGCTG
CCAAGGAGAAGGAGATTGAAGAGAAGAGACTACAGGCAATCAAGGACAAGCGCGAGGCAGAGGAAAAGGCCAAGG
AGGAGCAGCGTCTAGCCAAGCAGGAAGCTGCGGCCAAGGCTGAAGCCGAAGCGGAAAAGGCGGCCAAGGAGCAGG
CAGCGGCCAAGAAGCTTGCCGAGGAAAAGGCCAAGGCGGAGCAGCAGGCGGCAGCCAAGGCAGCCGAGCCGGAGC
AACAGGTTACAAATTCTGGGCCGCAGAAGCCCAACGGGGCATTGGCGGCTGAAGCCAAGGTGGCACAGCGAGGAC
GCGACGGCTACGAAGCACGCGAGCCACGGGAGCCCAAAGATCAAGTGAGCAACTACAAGTCGAGAGCAGCTGAAG
CAGGCAACTGGAGATCAGCATCCAATGAGCAGCGGCTGGGACGCGGACCATCTGGCGGAGGCAGAGGTGGACGAG
GGGGGGGCGGTGGTGGTCGAGGGTCGCGCTTTGACAACCGCGGTCCACGGTCCAACGGGTCGCCTGCACATCATC
ACCACCATCATCATCAGCAACAGGCAGGACAGCAGCATTCGCAGCAGGCTGCGGGACAAACAGGTGGTGGCGAGG
CAGCAAGCAAGCAGGCGAATGCGCCTGATGAGGAAGGATGGACTACGGTTCCAAACAAGAAGGGACGACAGAACC
GCGCGTTGGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail