Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|539
Gene name
LocationContig_1127:658..1417
Strand+
Gene length (bp)759
Transcript length (bp)759
Coding sequence length (bp)759
Protein length (aa) 253

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6606
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|539 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6234
Ophiocordyceps subramaniannii Hirsu2|3524

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|539
MTTRCNGLETSIWAAPRCHPQPRGGQPNTSHETPPPRPKSSGPIHALKRFEQTCGRIRWKAIDLSNAYQRTERPS
NWSFSTLDAERNFKVDFHEFYVWIEQAVVLLLGVFGTSIDARPRRDTSTVPPAGHAFHHNVLMALSDEMHPLHES
LGTGDVKHALSKAKELRNRWKDVALGQQQAQNPPLKMYDLEWIVAKVMTGLESAYAVAAQRVRLELETAGIDLEM
QQAQAVEAEDEWQWMVEPMDWEANDSL*
Coding >OphauG2|539
ATGACGACGCGATGCAACGGGCTTGAGACATCCATCTGGGCAGCGCCGAGATGCCACCCGCAGCCACGGGGCGGC
CAACCAAACACCAGCCACGAAACCCCGCCGCCTCGGCCCAAATCATCCGGCCCAATCCACGCACTCAAGCGGTTT
GAGCAAACGTGCGGCCGTATCCGGTGGAAGGCAATCGACCTCAGCAACGCATATCAGCGGACAGAAAGACCGTCC
AACTGGTCGTTTAGCACGCTAGACGCAGAGCGCAACTTCAAGGTGGACTTTCACGAGTTTTATGTGTGGATCGAA
CAGGCCGTGGTGCTGCTGCTCGGCGTCTTTGGAACAAGCATTGACGCGCGGCCACGCCGAGACACAAGCACAGTG
CCGCCGGCGGGGCATGCCTTTCATCACAATGTGCTCATGGCGCTGAGTGACGAGATGCATCCGCTGCATGAGTCG
CTGGGCACGGGCGACGTCAAGCATGCGTTGAGCAAGGCAAAGGAGCTGCGGAACCGGTGGAAAGACGTGGCGCTG
GGGCAGCAGCAGGCGCAGAACCCGCCTCTCAAGATGTATGACTTGGAGTGGATCGTGGCCAAGGTGATGACGGGT
CTCGAAAGTGCTTACGCTGTTGCTGCGCAGAGAGTGCGTCTGGAATTGGAAACGGCGGGCATCGACTTGGAGATG
CAGCAAGCCCAGGCAGTCGAGGCGGAGGATGAGTGGCAGTGGATGGTTGAGCCTATGGACTGGGAGGCTAACGAC
TCTTTGTGA
Transcript >OphauG2|539
ATGACGACGCGATGCAACGGGCTTGAGACATCCATCTGGGCAGCGCCGAGATGCCACCCGCAGCCACGGGGCGGC
CAACCAAACACCAGCCACGAAACCCCGCCGCCTCGGCCCAAATCATCCGGCCCAATCCACGCACTCAAGCGGTTT
GAGCAAACGTGCGGCCGTATCCGGTGGAAGGCAATCGACCTCAGCAACGCATATCAGCGGACAGAAAGACCGTCC
AACTGGTCGTTTAGCACGCTAGACGCAGAGCGCAACTTCAAGGTGGACTTTCACGAGTTTTATGTGTGGATCGAA
CAGGCCGTGGTGCTGCTGCTCGGCGTCTTTGGAACAAGCATTGACGCGCGGCCACGCCGAGACACAAGCACAGTG
CCGCCGGCGGGGCATGCCTTTCATCACAATGTGCTCATGGCGCTGAGTGACGAGATGCATCCGCTGCATGAGTCG
CTGGGCACGGGCGACGTCAAGCATGCGTTGAGCAAGGCAAAGGAGCTGCGGAACCGGTGGAAAGACGTGGCGCTG
GGGCAGCAGCAGGCGCAGAACCCGCCTCTCAAGATGTATGACTTGGAGTGGATCGTGGCCAAGGTGATGACGGGT
CTCGAAAGTGCTTACGCTGTTGCTGCGCAGAGAGTGCGTCTGGAATTGGAAACGGCGGGCATCGACTTGGAGATG
CAGCAAGCCCAGGCAGTCGAGGCGGAGGATGAGTGGCAGTGGATGGTTGAGCCTATGGACTGGGAGGCTAACGAC
TCTTTGTGA
Gene >OphauG2|539
ATGACGACGCGATGCAACGGGCTTGAGACATCCATCTGGGCAGCGCCGAGATGCCACCCGCAGCCACGGGGCGGC
CAACCAAACACCAGCCACGAAACCCCGCCGCCTCGGCCCAAATCATCCGGCCCAATCCACGCACTCAAGCGGTTT
GAGCAAACGTGCGGCCGTATCCGGTGGAAGGCAATCGACCTCAGCAACGCATATCAGCGGACAGAAAGACCGTCC
AACTGGTCGTTTAGCACGCTAGACGCAGAGCGCAACTTCAAGGTGGACTTTCACGAGTTTTATGTGTGGATCGAA
CAGGCCGTGGTGCTGCTGCTCGGCGTCTTTGGAACAAGCATTGACGCGCGGCCACGCCGAGACACAAGCACAGTG
CCGCCGGCGGGGCATGCCTTTCATCACAATGTGCTCATGGCGCTGAGTGACGAGATGCATCCGCTGCATGAGTCG
CTGGGCACGGGCGACGTCAAGCATGCGTTGAGCAAGGCAAAGGAGCTGCGGAACCGGTGGAAAGACGTGGCGCTG
GGGCAGCAGCAGGCGCAGAACCCGCCTCTCAAGATGTATGACTTGGAGTGGATCGTGGCCAAGGTGATGACGGGT
CTCGAAAGTGCTTACGCTGTTGCTGCGCAGAGAGTGCGTCTGGAATTGGAAACGGCGGGCATCGACTTGGAGATG
CAGCAAGCCCAGGCAGTCGAGGCGGAGGATGAGTGGCAGTGGATGGTTGAGCCTATGGACTGGGAGGCTAACGAC
TCTTTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail