Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5387
Gene name
LocationContig_494:9982..12643
Strand+
Gene length (bp)2661
Transcript length (bp)2526
Coding sequence length (bp)2526
Protein length (aa) 842

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00888 Cullin Cullin family 5.0E-165 105 743
PF10557 Cullin_Nedd8 Cullin protein neddylation domain 1.5E-25 774 835

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q13619|CUL4A_HUMAN Cullin-4A OS=Homo sapiens GN=CUL4A PE=1 SV=3 78 841 5.0E-146
sp|Q3TCH7|CUL4A_MOUSE Cullin-4A OS=Mus musculus GN=Cul4a PE=1 SV=1 53 841 2.0E-141
sp|A2A432|CUL4B_MOUSE Cullin-4B OS=Mus musculus GN=Cul4b PE=1 SV=1 48 841 3.0E-139
sp|Q13620|CUL4B_HUMAN Cullin-4B OS=Homo sapiens GN=CUL4B PE=1 SV=4 48 841 1.0E-138
sp|Q8LGH4|CUL4_ARATH Cullin-4 OS=Arabidopsis thaliana GN=CUL4 PE=1 SV=1 46 841 1.0E-131
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q13619|CUL4A_HUMAN Cullin-4A OS=Homo sapiens GN=CUL4A PE=1 SV=3 78 841 5.0E-146
sp|Q3TCH7|CUL4A_MOUSE Cullin-4A OS=Mus musculus GN=Cul4a PE=1 SV=1 53 841 2.0E-141
sp|A2A432|CUL4B_MOUSE Cullin-4B OS=Mus musculus GN=Cul4b PE=1 SV=1 48 841 3.0E-139
sp|Q13620|CUL4B_HUMAN Cullin-4B OS=Homo sapiens GN=CUL4B PE=1 SV=4 48 841 1.0E-138
sp|Q8LGH4|CUL4_ARATH Cullin-4 OS=Arabidopsis thaliana GN=CUL4 PE=1 SV=1 46 841 1.0E-131
sp|O14122|CUL4_SCHPO Cullin-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cul4 PE=1 SV=1 78 841 1.0E-119
sp|Q54CS2|CUL4_DICDI Cullin-4 OS=Dictyostelium discoideum GN=culD PE=3 SV=1 105 841 2.0E-111
sp|Q9ZVH4|CUL3A_ARATH Cullin-3A OS=Arabidopsis thaliana GN=CUL3A PE=1 SV=1 98 841 6.0E-96
sp|Q9C9L0|CUL3B_ARATH Cullin-3B OS=Arabidopsis thaliana GN=CUL3B PE=1 SV=1 107 841 6.0E-94
sp|Q54NZ5|CUL3_DICDI Cullin-3 OS=Dictyostelium discoideum GN=culC PE=3 SV=1 107 841 1.0E-90
sp|B5DF89|CUL3_RAT Cullin-3 OS=Rattus norvegicus GN=Cul3 PE=1 SV=2 107 841 1.0E-86
sp|Q9JLV5|CUL3_MOUSE Cullin-3 OS=Mus musculus GN=Cul3 PE=1 SV=1 107 841 3.0E-86
sp|Q13618|CUL3_HUMAN Cullin-3 OS=Homo sapiens GN=CUL3 PE=1 SV=2 107 841 3.0E-86
sp|Q6GPF3|CUL3B_XENLA Cullin-3-B OS=Xenopus laevis GN=cul3b PE=1 SV=1 107 841 6.0E-86
sp|Q6DE95|CUL3A_XENLA Cullin-3-A OS=Xenopus laevis GN=cul3a PE=1 SV=1 107 841 1.0E-85
sp|A4IHP4|CUL3_XENTR Cullin-3 OS=Xenopus tropicalis GN=cul3 PE=2 SV=1 107 841 1.0E-85
sp|Q94AH6|CUL1_ARATH Cullin-1 OS=Arabidopsis thaliana GN=CUL1 PE=1 SV=1 127 841 9.0E-85
sp|Q17391|CUL3_CAEEL Cullin-3 OS=Caenorhabditis elegans GN=cul-3 PE=1 SV=2 98 841 2.0E-84
sp|Q9SRZ0|CUL2_ARATH Cullin-2 OS=Arabidopsis thaliana GN=CUL2 PE=1 SV=1 120 841 1.0E-76
sp|Q09760|CUL3_SCHPO Cullin-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cul3 PE=1 SV=2 78 841 3.0E-71
sp|Q9WTX6|CUL1_MOUSE Cullin-1 OS=Mus musculus GN=Cul1 PE=1 SV=1 138 841 1.0E-65
sp|Q5R4G6|CUL1_PONAB Cullin-1 OS=Pongo abelii GN=CUL1 PE=2 SV=1 138 841 1.0E-65
sp|Q13616|CUL1_HUMAN Cullin-1 OS=Homo sapiens GN=CUL1 PE=1 SV=2 138 841 1.0E-65
sp|P0CH31|CLL1_ARATH Putative cullin-like protein 1 OS=Arabidopsis thaliana GN=At1g43140 PE=3 SV=1 183 841 9.0E-64
sp|Q24311|CUL1_DROME Cullin homolog 1 OS=Drosophila melanogaster GN=Cul1 PE=1 SV=2 136 841 4.0E-63
sp|O60999|CUL1_DICDI Cullin-1 OS=Dictyostelium discoideum GN=culA PE=1 SV=1 92 841 4.0E-62
sp|O13790|CUL1_SCHPO Cullin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cul1 PE=1 SV=1 127 841 1.0E-58
sp|Q17389|CUL1_CAEEL Cullin-1 OS=Caenorhabditis elegans GN=cul-1 PE=1 SV=1 136 841 6.0E-57
sp|Q17392|CUL4_CAEEL Cullin-4 OS=Caenorhabditis elegans GN=cul-4 PE=1 SV=3 5 841 8.0E-57
sp|Q9XZJ3|CUL2_DICDI Cullin-2 OS=Dictyostelium discoideum GN=culB PE=2 SV=1 272 841 1.0E-55
sp|Q54XF7|CUL5_DICDI Cullin-5 OS=Dictyostelium discoideum GN=culE PE=3 SV=1 268 841 4.0E-53
sp|Q9D4H8|CUL2_MOUSE Cullin-2 OS=Mus musculus GN=Cul2 PE=1 SV=2 228 841 5.0E-50
sp|Q17390|CUL2_CAEEL Cullin-2 OS=Caenorhabditis elegans GN=cul-2 PE=1 SV=3 114 841 6.0E-50
sp|Q5RCF3|CUL2_PONAB Cullin-2 OS=Pongo abelii GN=CUL2 PE=2 SV=1 270 841 2.0E-49
sp|Q13617|CUL2_HUMAN Cullin-2 OS=Homo sapiens GN=CUL2 PE=1 SV=2 270 841 2.0E-49
sp|Q23639|CUL5_CAEEL Cullin-5 OS=Caenorhabditis elegans GN=cul-5 PE=1 SV=2 270 841 3.0E-49
sp|Q21346|CUL6_CAEEL Cullin-6 OS=Caenorhabditis elegans GN=cul-6 PE=1 SV=1 116 841 2.0E-48
sp|Q9JJ31|CUL5_RAT Cullin-5 OS=Rattus norvegicus GN=Cul5 PE=1 SV=3 127 841 1.0E-46
sp|Q12018|CDC53_YEAST Cell division control protein 53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC53 PE=1 SV=1 149 841 2.0E-46
sp|Q9D5V5|CUL5_MOUSE Cullin-5 OS=Mus musculus GN=Cul5 PE=1 SV=3 127 841 3.0E-46
sp|Q93034|CUL5_HUMAN Cullin-5 OS=Homo sapiens GN=CUL5 PE=1 SV=4 127 841 2.0E-45
sp|Q5RB36|CUL5_PONAB Cullin-5 OS=Pongo abelii GN=CUL5 PE=2 SV=3 127 841 4.0E-45
sp|Q29425|CUL5_RABIT Cullin-5 OS=Oryctolagus cuniculus GN=CUL5 PE=2 SV=3 127 841 3.0E-43
sp|P53202|CUL3_YEAST Cullin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CUL3 PE=1 SV=1 478 841 3.0E-28
sp|Q9UJX6|ANC2_HUMAN Anaphase-promoting complex subunit 2 OS=Homo sapiens GN=ANAPC2 PE=1 SV=1 525 728 2.0E-11
sp|Q8BZQ7|ANC2_MOUSE Anaphase-promoting complex subunit 2 OS=Mus musculus GN=Anapc2 PE=1 SV=2 525 684 3.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0031625 ubiquitin protein ligase binding Yes
GO:0006511 ubiquitin-dependent protein catabolic process Yes
GO:0043170 macromolecule metabolic process No
GO:0044389 ubiquitin-like protein ligase binding No
GO:0019538 protein metabolic process No
GO:0009057 macromolecule catabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0044238 primary metabolic process No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0019899 enzyme binding No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0005515 protein binding No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0019941 modification-dependent protein catabolic process No
GO:0006508 proteolysis No
GO:0044260 cellular macromolecule metabolic process No
GO:0044248 cellular catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:1901575 organic substance catabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5077
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5387 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2630
Ophiocordyceps camponoti-floridani Ophcf2|01964
Ophiocordyceps camponoti-rufipedis Ophun1|3889
Ophiocordyceps kimflemingae Ophio5|5907
Ophiocordyceps subramaniannii Hirsu2|2928

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5387
MQDSSSPRSRRRPRLSSSSSSSAAAAVATKRARYEYSTDANTAVDAPSAMASARAKGKMPEAAALPVRPTPSNPL
SSSKKLLIRNFRKHDGREAKVHEYYARVEQQLDSAVGALLNGTWPHVPLESLYRGVEDVCRRGDADKILTMLDDR
IGSHLQTAVLPRIQAAANMSDLDVLRSFMKEWKVWMTQTVTIRSTFSYFDRTYLLRGRFPCINEMAISHFRRVTF
SAKGAASLGLQVIAGICQIFEYDRRHDERLDQALLKDSIRMLNVLGVYVQYFDPIFLQQSEAYYRDFGKSWADAS
LKDYIAAVETLLAREHHRCITYSLDSTTEKRMMDWAHEILISHYSERLLHSTSLAHLLEGKDVKSMKGLYQLLQL
SGLEKKVKTPWAEYIKTAGASIISDKDRGDEMVLRLLELRRSLDLMIRDAFGMDDDFLWAMREGFGGFMNDRKTA
LCWETGTSKVGEMTAKYIDMLLRGGTKALPSELLSDVKDRIKAEKQGEASSADEEAELDRQLDQALELFRFIEGK
DTFEAFYKRDLARRLLMRRSASQDAERNMLTKLRGECGSNFTHNLEQMFKDQELAKDEMDSYRQLQLAKLDQKPP
VDLDVMILSAAAWPSFPDLPLKLPDQVATQIERFDAHYKKKHTGRVLTWKHTLAHCVMTAVYPKGTKELLVSASQ
AVVLMLFNSLPDDGFLSYEQVSFATGLQGGELNRTLQSLACGKARVLSKHPKGRDVKQSDTFTFNRGFSDAKYRV
KINQIQLRETKDENKATHERIAQDRRFETQAAIVRIMKSRKRMTHGDLVAEVINMTKKRGSVEPAAIKKEIESLI
EKDYLEREDNAYTYLA*
Coding >OphauG2|5387
ATGCAAGACAGCAGCAGCCCCCGTTCTCGCCGCAGGCCTCGCCTCTCGTCGTCATCGTCTTCGTCGGCCGCCGCG
GCTGTCGCGACGAAGCGTGCCAGATACGAGTATTCGACCGACGCCAACACGGCTGTCGACGCGCCTTCGGCCATG
GCAAGTGCCCGAGCCAAGGGCAAGATGCCCGAGGCGGCGGCCCTGCCGGTGCGCCCCACGCCTTCGAATCCACTC
AGCAGCTCCAAGAAGCTTCTTATCAGGAATTTCAGGAAACATGATGGCCGTGAAGCAAAGGTGCACGAGTACTAC
GCCCGTGTTGAGCAGCAGCTAGACAGTGCCGTCGGGGCGCTGCTGAACGGGACCTGGCCCCATGTTCCCCTCGAG
TCTCTCTACCGCGGGGTAGAAGATGTCTGTCGACGCGGTGATGCCGACAAGATCCTGACGATGCTCGATGACCGC
ATTGGCAGCCATCTGCAGACTGCAGTCCTACCGAGGATACAGGCTGCTGCAAATATGTCAGACCTGGATGTCCTC
AGGAGCTTCATGAAGGAGTGGAAGGTTTGGATGACGCAGACTGTCACCATTAGATCGACTTTTAGCTATTTTGAT
CGTACATATCTCTTACGCGGGCGATTTCCCTGCATCAACGAGATGGCCATATCTCACTTCCGCCGAGTCACCTTT
TCTGCCAAGGGAGCAGCATCTTTAGGATTACAGGTCATTGCGGGAATCTGCCAAATATTTGAATACGACCGTCGC
CACGACGAGCGTCTGGACCAGGCTCTTCTCAAGGACTCAATACGCATGCTCAATGTCTTGGGTGTCTATGTTCAG
TATTTCGATCCCATTTTTCTGCAGCAGTCTGAGGCATATTACAGAGACTTTGGCAAGTCGTGGGCCGACGCAAGC
CTCAAGGACTACATTGCGGCCGTCGAAACACTGCTAGCCCGGGAGCATCATAGATGCATCACGTATAGTCTGGAC
AGCACTACGGAAAAGAGAATGATGGATTGGGCGCATGAAATACTCATCAGCCATTACTCGGAACGACTGCTACAC
AGCACCAGCCTGGCACATCTCTTGGAGGGAAAGGACGTCAAGTCAATGAAGGGCCTCTACCAGCTGCTACAGCTG
TCGGGCCTGGAAAAAAAAGTCAAGACACCGTGGGCAGAGTACATTAAAACAGCAGGAGCGTCCATCATCTCTGAC
AAGGACCGAGGAGACGAAATGGTATTGCGATTACTGGAGCTGCGCCGATCGCTGGACCTGATGATTCGTGACGCC
TTTGGCATGGACGATGACTTCTTGTGGGCCATGAGAGAAGGCTTTGGTGGCTTCATGAACGACCGTAAGACGGCG
CTTTGCTGGGAAACGGGCACCTCTAAGGTAGGCGAGATGACTGCAAAGTACATTGACATGCTGCTGCGCGGGGGC
ACCAAGGCTTTGCCCAGCGAACTGCTTTCGGATGTCAAGGACAGAATCAAGGCGGAAAAGCAGGGCGAAGCCAGC
AGCGCCGACGAGGAAGCAGAGCTGGATCGCCAGCTCGACCAAGCCCTGGAGCTGTTCCGCTTCATCGAGGGCAAG
GACACGTTTGAGGCCTTTTACAAGCGAGACTTGGCGCGGCGCCTTCTGATGCGCCGAAGCGCCAGCCAGGATGCC
GAGCGCAACATGCTCACCAAGCTGCGAGGCGAGTGCGGCTCCAACTTTACGCACAACCTGGAGCAGATGTTCAAG
GACCAGGAGCTTGCCAAGGACGAAATGGATTCCTACAGGCAGCTGCAGCTGGCCAAGCTGGACCAGAAACCGCCG
GTGGACTTGGACGTCATGATCCTGTCGGCTGCGGCATGGCCTTCGTTTCCTGATCTGCCGCTCAAGCTGCCCGAC
CAAGTGGCGACGCAGATTGAGCGCTTCGACGCGCACTACAAGAAGAAGCACACGGGACGCGTTTTGACGTGGAAG
CACACGCTGGCGCACTGCGTCATGACGGCGGTCTATCCCAAGGGGACCAAGGAGCTACTGGTTTCAGCATCGCAG
GCAGTGGTGCTTATGCTCTTTAATAGCCTGCCCGACGACGGCTTCCTCTCGTATGAGCAAGTGTCGTTTGCTACA
GGGCTTCAGGGCGGCGAGCTGAACCGTACGCTGCAATCGCTAGCCTGCGGTAAGGCGCGAGTGCTATCAAAACAC
CCCAAGGGGCGCGATGTGAAGCAAAGCGACACATTTACCTTTAACCGTGGCTTTTCAGACGCCAAGTACCGCGTC
AAAATCAACCAGATCCAACTGAGGGAGACCAAGGACGAGAACAAGGCAACACACGAGCGCATTGCGCAGGACCGC
CGGTTTGAGACGCAGGCGGCTATTGTGCGCATCATGAAGAGCCGCAAACGCATGACGCATGGCGATCTTGTTGCC
GAAGTAATCAACATGACCAAGAAGCGAGGCAGTGTAGAGCCGGCCGCCATCAAGAAGGAAATTGAGAGTCTTATC
GAAAAGGACTACCTGGAGCGGGAAGACAATGCATATACATATCTTGCGTGA
Transcript >OphauG2|5387
ATGCAAGACAGCAGCAGCCCCCGTTCTCGCCGCAGGCCTCGCCTCTCGTCGTCATCGTCTTCGTCGGCCGCCGCG
GCTGTCGCGACGAAGCGTGCCAGATACGAGTATTCGACCGACGCCAACACGGCTGTCGACGCGCCTTCGGCCATG
GCAAGTGCCCGAGCCAAGGGCAAGATGCCCGAGGCGGCGGCCCTGCCGGTGCGCCCCACGCCTTCGAATCCACTC
AGCAGCTCCAAGAAGCTTCTTATCAGGAATTTCAGGAAACATGATGGCCGTGAAGCAAAGGTGCACGAGTACTAC
GCCCGTGTTGAGCAGCAGCTAGACAGTGCCGTCGGGGCGCTGCTGAACGGGACCTGGCCCCATGTTCCCCTCGAG
TCTCTCTACCGCGGGGTAGAAGATGTCTGTCGACGCGGTGATGCCGACAAGATCCTGACGATGCTCGATGACCGC
ATTGGCAGCCATCTGCAGACTGCAGTCCTACCGAGGATACAGGCTGCTGCAAATATGTCAGACCTGGATGTCCTC
AGGAGCTTCATGAAGGAGTGGAAGGTTTGGATGACGCAGACTGTCACCATTAGATCGACTTTTAGCTATTTTGAT
CGTACATATCTCTTACGCGGGCGATTTCCCTGCATCAACGAGATGGCCATATCTCACTTCCGCCGAGTCACCTTT
TCTGCCAAGGGAGCAGCATCTTTAGGATTACAGGTCATTGCGGGAATCTGCCAAATATTTGAATACGACCGTCGC
CACGACGAGCGTCTGGACCAGGCTCTTCTCAAGGACTCAATACGCATGCTCAATGTCTTGGGTGTCTATGTTCAG
TATTTCGATCCCATTTTTCTGCAGCAGTCTGAGGCATATTACAGAGACTTTGGCAAGTCGTGGGCCGACGCAAGC
CTCAAGGACTACATTGCGGCCGTCGAAACACTGCTAGCCCGGGAGCATCATAGATGCATCACGTATAGTCTGGAC
AGCACTACGGAAAAGAGAATGATGGATTGGGCGCATGAAATACTCATCAGCCATTACTCGGAACGACTGCTACAC
AGCACCAGCCTGGCACATCTCTTGGAGGGAAAGGACGTCAAGTCAATGAAGGGCCTCTACCAGCTGCTACAGCTG
TCGGGCCTGGAAAAAAAAGTCAAGACACCGTGGGCAGAGTACATTAAAACAGCAGGAGCGTCCATCATCTCTGAC
AAGGACCGAGGAGACGAAATGGTATTGCGATTACTGGAGCTGCGCCGATCGCTGGACCTGATGATTCGTGACGCC
TTTGGCATGGACGATGACTTCTTGTGGGCCATGAGAGAAGGCTTTGGTGGCTTCATGAACGACCGTAAGACGGCG
CTTTGCTGGGAAACGGGCACCTCTAAGGTAGGCGAGATGACTGCAAAGTACATTGACATGCTGCTGCGCGGGGGC
ACCAAGGCTTTGCCCAGCGAACTGCTTTCGGATGTCAAGGACAGAATCAAGGCGGAAAAGCAGGGCGAAGCCAGC
AGCGCCGACGAGGAAGCAGAGCTGGATCGCCAGCTCGACCAAGCCCTGGAGCTGTTCCGCTTCATCGAGGGCAAG
GACACGTTTGAGGCCTTTTACAAGCGAGACTTGGCGCGGCGCCTTCTGATGCGCCGAAGCGCCAGCCAGGATGCC
GAGCGCAACATGCTCACCAAGCTGCGAGGCGAGTGCGGCTCCAACTTTACGCACAACCTGGAGCAGATGTTCAAG
GACCAGGAGCTTGCCAAGGACGAAATGGATTCCTACAGGCAGCTGCAGCTGGCCAAGCTGGACCAGAAACCGCCG
GTGGACTTGGACGTCATGATCCTGTCGGCTGCGGCATGGCCTTCGTTTCCTGATCTGCCGCTCAAGCTGCCCGAC
CAAGTGGCGACGCAGATTGAGCGCTTCGACGCGCACTACAAGAAGAAGCACACGGGACGCGTTTTGACGTGGAAG
CACACGCTGGCGCACTGCGTCATGACGGCGGTCTATCCCAAGGGGACCAAGGAGCTACTGGTTTCAGCATCGCAG
GCAGTGGTGCTTATGCTCTTTAATAGCCTGCCCGACGACGGCTTCCTCTCGTATGAGCAAGTGTCGTTTGCTACA
GGGCTTCAGGGCGGCGAGCTGAACCGTACGCTGCAATCGCTAGCCTGCGGTAAGGCGCGAGTGCTATCAAAACAC
CCCAAGGGGCGCGATGTGAAGCAAAGCGACACATTTACCTTTAACCGTGGCTTTTCAGACGCCAAGTACCGCGTC
AAAATCAACCAGATCCAACTGAGGGAGACCAAGGACGAGAACAAGGCAACACACGAGCGCATTGCGCAGGACCGC
CGGTTTGAGACGCAGGCGGCTATTGTGCGCATCATGAAGAGCCGCAAACGCATGACGCATGGCGATCTTGTTGCC
GAAGTAATCAACATGACCAAGAAGCGAGGCAGTGTAGAGCCGGCCGCCATCAAGAAGGAAATTGAGAGTCTTATC
GAAAAGGACTACCTGGAGCGGGAAGACAATGCATATACATATCTTGCGTGA
Gene >OphauG2|5387
ATGCAAGACAGCAGCAGCCCCCGTTCTCGCCGCAGGCCTCGCCTCTCGTCGTCATCGTCTTCGTCGGCCGCCGCG
GCTGTCGCGACGAAGCGTGCCAGATACGAGTATTCGACCGACGCCAACACGGCTGTCGACGCGCCTTCGGCCATG
GCAAGTGCCCGAGCCAAGGGCAAGATGCCCGAGGCGGCGGCCCTGCCGGTGCGCCCCACGCCTTCGAATCCACTC
AGCAGCTCCAAGAAGCTTCTTATCAGGAATTTCAGGAAACATGATGGCCGTGAAGCAAAGGTGCACGAGTACTAC
GCCCGTGTTGAGCAGCAGCTAGACAGTGCCGTCGGGGCGCTGCTGAACGGGACCTGGCCCCATGTTCCCCTCGAG
TCTCTCTACCGCGGGGTAGAAGATGTCTGTCGACGCGGTGATGCCGACAAGATCCTGACGATGCTCGATGACCGC
ATTGGCAGCCATCTGCAGACTGCAGTCCTACCGAGGATACAGGCTGCTGCAAATATGTCAGACCTGGATGTCCTC
AGGAGCTTCATGAAGGAGTGGAAGGTTTGGATGACGCAGACTGTGAGTCGCCCATGCAGCGAGGCCCAGCTGCTT
CCGCTTGGTGCTGATTCTCTGCCCGTGCCCTGTTTAGGTCACCATTAGATCGACTTTTAGCTATTTTGATCGTAC
ATATCTCTTACGCGGGCGATTTCCCTGCATCAACGAGATGGCCATATCTCACTTCCGCCGAGTCACCTTTTCTGC
CAAGGGAGCAGCATCTTTAGGATTACAGGTCATTGCGGGAATCTGCCAAATATTTGAATACGACCGTCGCCACGA
CGAGCGTCTGGACCAGGCTCTTCTCAAGGACTCAATACGCATGCTCAATGTCTTGGGTGTCTATGTTCAGTATTT
CGATCCCATTTTTCTGCAGCAGTCTGAGGCATATTACAGAGACTTTGGCAAGTCGTGGGCCGACGCAAGCCTCAA
GGACTACATTGCGGCCGTCGAAACACTGCTAGCCCGGGAGCATCATAGATGCATCACGTATAGTCTGGACAGCAC
TACGGAAAAGAGAATGATGGATTGGGCGCATGAAATACTCATCAGCCATTACTCGGAACGACTGCTACACAGCAC
CAGCCTGGCACATCTCTTGGAGGGAAAGGACGTCAAGTCAATGAAGGGCCTCTACCAGCTGCTACAGCTGTCGGG
CCTGGAAAAAAAAGTCAAGACACCGTGGGCAGAGTACATTAAAACAGCAGGAGCGTCCATCATCTCTGACAAGGA
CCGAGGAGACGAAATGGTATTGCGATTACTGGAGCTGCGCCGATCGCTGGACCTGATGATTCGTGACGCCTTTGG
CATGGACGATGACTTCTTGTGGGCCATGAGAGAAGGCTTTGGTGGCTTCATGAACGACCGTAAGACGGCGCTTTG
CTGGGAAACGGGCACCTCTAAGGTAGGCGAGATGACTGCAAAGTACATTGACATGCTGCTGCGCGGGGGCACCAA
GGCTTTGCCCAGCGAACTGCTTTCGGATGTCAAGGACAGAATCAAGGCGGAAAAGCAGGGCGAAGCCAGCAGCGC
CGACGAGGAAGCAGAGCTGGATCGCCAGCTCGACCAAGCCCTGGAGCTGTTCCGCTTCATCGAGGGCAAGGACAC
GTTTGAGGCCTTTTACAAGCGAGACTTGGCGCGGCGCCTTCTGATGCGCCGAAGCGCCAGCCAGGATGCCGAGCG
CAACATGCTCACCAAGCTGCGAGGCGAGTGCGGCTCCAACTTTACGCACAACCTGGAGCAGATGTTCAAGGACCA
GGAGCTTGCCAAGGACGAAATGGATTCCTACAGGCAGCTGCAGCTGGCCAAGCTGGACCAGAAACCGCCGGTGGA
CTTGGACGTCATGATCCTGTCGGCTGCGGCATGGCCTTCGTTTCCTGATCTGCCGCTCAAGCTGCCCGACCAAGT
GGCGACGCAGATTGAGCGCTTCGACGCGCACTACAAGAAGAAGCACACGGGACGCGTTTTGACGTGGAAGCACAC
GCTGGCGCACTGCGTCATGACGGCGGTCTATCCCAAGGGGACCAAGGAGCTACTGGTTTCAGCATCGCAGGCAGT
GGTGCTTATGCTCTTTAATAGCCTGCCCGACGACGGCTTCCTCTCGTATGAGCAAGTGTCGTTTGCTACAGGGCT
TCAGGGCGGCGAGCTGAACCGTACGCTGCAATCGCTAGCCTGCGGTAAGGCGCGAGTGCTATCAAAACACCCCAA
GGGGCGCGATGTGAAGCAAAGCGACACATTTACCTTTAACCGTGGCTTTTCAGACGCCAAGTACCGCGTCAAAAT
CAACCAGATCCAACTGAGGGAGACCAAGGACGAGAACAAGGCAACACACGAGCGCATTGCGCAGGACCGCCGGTT
TGAGACGCAGGCGGCTATTGTGCGCATCATGAAGAGCCGCAAACGCATGACGCATGGCGATCTTGTTGCCGAAGT
AATCAACATGACCAAGAAGCGAGGCAGTGTAGAGCCGGCCGCCATCAAGAAGGAAATTGAGAGGTAAGACGCTGG
CGCTGTTGCAGCAATAGCTGTGGTTGGTGGCTAACGTGGGGCAACGAAAACAGTCTTATCGAAAAGGACTACCTG
GAGCGGGAAGACAATGCATATACATATCTTGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail