Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5375
Gene name
LocationContig_492:824..1482
Strand-
Gene length (bp)658
Transcript length (bp)597
Coding sequence length (bp)597
Protein length (aa) 199

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.4E-11 77 140

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B7P877|NCBP2_IXOSC Nuclear cap-binding protein subunit 2 OS=Ixodes scapularis GN=Cbp20 PE=3 SV=1 45 186 3.0E-56
sp|B5G279|NCBP2_TAEGU Nuclear cap-binding protein subunit 2 OS=Taeniopygia guttata GN=NCBP2 PE=2 SV=1 28 185 8.0E-56
sp|Q5ZKR5|NCBP2_CHICK Nuclear cap-binding protein subunit 2 OS=Gallus gallus GN=NCBP2 PE=2 SV=1 26 185 2.0E-55
sp|Q9P383|NCBP2_SCHPO Nuclear cap-binding protein subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cbc2 PE=3 SV=1 7 179 2.0E-54
sp|Q54KR9|NCBP2_DICDI Nuclear cap-binding protein subunit 2 OS=Dictyostelium discoideum GN=ncbp2 PE=3 SV=1 45 179 3.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B7P877|NCBP2_IXOSC Nuclear cap-binding protein subunit 2 OS=Ixodes scapularis GN=Cbp20 PE=3 SV=1 45 186 3.0E-56
sp|B5G279|NCBP2_TAEGU Nuclear cap-binding protein subunit 2 OS=Taeniopygia guttata GN=NCBP2 PE=2 SV=1 28 185 8.0E-56
sp|Q5ZKR5|NCBP2_CHICK Nuclear cap-binding protein subunit 2 OS=Gallus gallus GN=NCBP2 PE=2 SV=1 26 185 2.0E-55
sp|Q9P383|NCBP2_SCHPO Nuclear cap-binding protein subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cbc2 PE=3 SV=1 7 179 2.0E-54
sp|Q54KR9|NCBP2_DICDI Nuclear cap-binding protein subunit 2 OS=Dictyostelium discoideum GN=ncbp2 PE=3 SV=1 45 179 3.0E-54
sp|P52299|NCBP2_XENLA Nuclear cap-binding protein subunit 2 OS=Xenopus laevis GN=ncbp2 PE=2 SV=2 45 183 3.0E-54
sp|B1WC40|NCBP2_RAT Nuclear cap-binding protein subunit 2 OS=Rattus norvegicus GN=Ncbp2 PE=1 SV=1 39 179 5.0E-54
sp|Q9CQ49|NCBP2_MOUSE Nuclear cap-binding protein subunit 2 OS=Mus musculus GN=Ncbp2 PE=1 SV=1 39 179 5.0E-54
sp|C0H859|NCBP2_SALSA Nuclear cap-binding protein subunit 2 OS=Salmo salar GN=ncbp2 PE=2 SV=1 45 182 9.0E-54
sp|Q3ZBJ1|NCBP2_BOVIN Nuclear cap-binding protein subunit 2 OS=Bos taurus GN=NCBP2 PE=2 SV=1 39 179 1.0E-53
sp|P52298|NCBP2_HUMAN Nuclear cap-binding protein subunit 2 OS=Homo sapiens GN=NCBP2 PE=1 SV=1 39 179 1.0E-53
sp|Q177H0|NCBP2_AEDAE Nuclear cap-binding protein subunit 2 OS=Aedes aegypti GN=Cbp20 PE=3 SV=1 45 186 1.0E-53
sp|Q6DES0|NCBP2_XENTR Nuclear cap-binding protein subunit 2 OS=Xenopus tropicalis GN=ncbp2 PE=2 SV=1 45 183 1.0E-53
sp|Q7QCB6|NCBP2_ANOGA Nuclear cap-binding protein subunit 2 OS=Anopheles gambiae GN=Cbp20 PE=3 SV=3 45 186 2.0E-53
sp|Q8JGR6|NCBP2_DANRE Nuclear cap-binding protein subunit 2 OS=Danio rerio GN=ncbp2 PE=2 SV=2 45 182 2.0E-53
sp|B0W939|NCBP2_CULQU Nuclear cap-binding protein subunit 2 OS=Culex quinquefasciatus GN=Cbp20 PE=3 SV=1 45 186 2.0E-53
sp|C1BY64|NCBP2_ESOLU Nuclear cap-binding protein subunit 2 OS=Esox lucius GN=ncbp2 PE=2 SV=1 45 181 5.0E-53
sp|B4LZ88|NCB2B_DROVI Nuclear cap-binding protein subunit 2B OS=Drosophila virilis GN=Cbp20-B PE=3 SV=1 44 182 5.0E-52
sp|B3LYP1|NCBP2_DROAN Nuclear cap-binding protein subunit 2 OS=Drosophila ananassae GN=Cbp20 PE=3 SV=1 44 184 5.0E-52
sp|B4JUT1|NCBP2_DROGR Nuclear cap-binding protein subunit 2 OS=Drosophila grimshawi GN=Cbp20 PE=3 SV=1 44 182 6.0E-52
sp|B4KCD5|NCBP2_DROMO Nuclear cap-binding protein subunit 2 OS=Drosophila mojavensis GN=Cbp20 PE=3 SV=1 44 182 1.0E-51
sp|B4NB54|NCBP2_DROWI Nuclear cap-binding protein subunit 2 OS=Drosophila willistoni GN=Cbp20 PE=3 SV=1 44 184 2.0E-51
sp|B4GLK8|NCBP2_DROPE Nuclear cap-binding protein subunit 2 OS=Drosophila persimilis GN=Cbp20 PE=3 SV=1 44 182 8.0E-51
sp|Q293V6|NCBP2_DROPS Nuclear cap-binding protein subunit 2 OS=Drosophila pseudoobscura pseudoobscura GN=Cbp20 PE=3 SV=1 44 182 8.0E-51
sp|A2SW84|NCBP2_SINCH Nuclear cap-binding protein subunit 2 OS=Siniperca chuatsi GN=ncbp2 PE=2 SV=1 45 185 1.0E-50
sp|B4QV17|NCBP2_DROSI Nuclear cap-binding protein subunit 2 OS=Drosophila simulans GN=Cbp20 PE=3 SV=1 44 182 2.0E-50
sp|B4IBA4|NCBP2_DROSE Nuclear cap-binding protein subunit 2 OS=Drosophila sechellia GN=Cbp20 PE=3 SV=1 44 182 2.0E-50
sp|Q9V3L6|NCBP2_DROME Nuclear cap-binding protein subunit 2 OS=Drosophila melanogaster GN=Cbp20 PE=1 SV=1 44 182 2.0E-50
sp|B4PL68|NCBP2_DROYA Nuclear cap-binding protein subunit 2 OS=Drosophila yakuba GN=Cbp20 PE=3 SV=1 44 182 2.0E-50
sp|B3P0D7|NCBP2_DROER Nuclear cap-binding protein subunit 2 OS=Drosophila erecta GN=Cbp20 PE=3 SV=1 44 182 4.0E-50
sp|Q84L14|NCBP2_ORYSJ Nuclear cap-binding protein subunit 2 OS=Oryza sativa subsp. japonica GN=CBP20 PE=2 SV=1 45 184 2.0E-49
sp|B4M205|NCB2A_DROVI Nuclear cap-binding protein subunit 2-A OS=Drosophila virilis GN=Cbp20-A PE=3 SV=1 44 184 4.0E-49
sp|Q1HE01|NCBP2_BOMMO Nuclear cap-binding protein subunit 2 OS=Bombyx mori PE=2 SV=1 45 167 2.0E-48
sp|Q9XFD1|NCBP2_ARATH Nuclear cap-binding protein subunit 2 OS=Arabidopsis thaliana GN=CBP20 PE=1 SV=1 43 184 8.0E-48
sp|A8Y1R8|NCBP2_CAEBR Nuclear cap-binding protein subunit 2 OS=Caenorhabditis briggsae GN=ncbp-2 PE=3 SV=2 12 186 8.0E-48
sp|Q754W7|NCBP2_ASHGO Nuclear cap-binding protein subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CBC2 PE=3 SV=1 8 176 1.0E-47
sp|Q93594|NCBP2_CAEEL Nuclear cap-binding protein subunit 2 OS=Caenorhabditis elegans GN=ncbp-2 PE=3 SV=2 8 181 2.0E-47
sp|Q08920|NCBP2_YEAST Nuclear cap-binding protein subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CBC2 PE=1 SV=1 8 186 4.0E-47
sp|A6PVI3|NCB2L_HUMAN Nuclear cap-binding protein subunit 2-like OS=Homo sapiens GN=NCBP2L PE=3 SV=1 45 179 1.0E-39
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 76 142 2.0E-07
sp|Q9DED4|CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis GN=cirbp-b PE=1 SV=1 76 142 1.0E-06
sp|Q5RF83|CIRBP_PONAB Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1 76 142 2.0E-06
sp|Q14011|CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1 76 142 2.0E-06
sp|P60825|CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus GN=Cirbp PE=2 SV=1 76 142 4.0E-06
sp|P60824|CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus GN=Cirbp PE=1 SV=1 76 142 4.0E-06
sp|P60826|CIRBP_CRIGR Cold-inducible RNA-binding protein OS=Cricetulus griseus GN=CIRBP PE=2 SV=1 76 142 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5375
MPPVIRSTVDRLDRPSAYFNNRNKRRRRDDDDAADEQLEPSVDPLANATTLYVGNLYALAIDLHAPVNLLTSLSS
SFYTTEEQVYELFSKCGEIKRLVMGLDRFQKTPCGFCFVEYYTHQDALDCMKYIGGTKLDERVIRTDLDPGFEEG
RQYGRGKSGGQVRDEYREDYDEGRGGVGRAINAERLRDYDEQGRYAAR*
Coding >OphauG2|5375
ATGCCGCCTGTCATCAGAAGCACCGTCGACCGCCTCGATAGACCAAGCGCTTACTTCAACAACAGGAACAAGCGG
AGACGCCGTGACGATGACGACGCAGCTGATGAACAGCTTGAACCCTCGGTCGACCCTCTTGCCAATGCCACAACT
CTCTATGTCGGCAATCTGTATGCGCTTGCCATTGACTTGCATGCTCCTGTAAACTTGCTGACCTCGCTCTCCAGC
TCTTTCTACACGACTGAGGAGCAAGTATACGAACTCTTCTCCAAATGCGGCGAGATTAAGCGACTGGTAATGGGC
CTGGACCGATTCCAAAAAACTCCCTGCGGCTTCTGCTTTGTCGAGTACTACACCCACCAAGATGCGCTGGATTGC
ATGAAGTATATTGGCGGCACCAAGCTCGACGAGCGCGTCATTCGCACCGACCTGGACCCGGGCTTCGAGGAGGGA
AGACAGTACGGGCGCGGCAAATCGGGCGGCCAGGTTAGAGATGAGTATCGCGAGGATTACGACGAAGGACGCGGT
GGCGTTGGTAGGGCTATCAATGCCGAGCGTCTGCGAGACTACGACGAACAAGGACGCTACGCAGCACGGTGA
Transcript >OphauG2|5375
ATGCCGCCTGTCATCAGAAGCACCGTCGACCGCCTCGATAGACCAAGCGCTTACTTCAACAACAGGAACAAGCGG
AGACGCCGTGACGATGACGACGCAGCTGATGAACAGCTTGAACCCTCGGTCGACCCTCTTGCCAATGCCACAACT
CTCTATGTCGGCAATCTGTATGCGCTTGCCATTGACTTGCATGCTCCTGTAAACTTGCTGACCTCGCTCTCCAGC
TCTTTCTACACGACTGAGGAGCAAGTATACGAACTCTTCTCCAAATGCGGCGAGATTAAGCGACTGGTAATGGGC
CTGGACCGATTCCAAAAAACTCCCTGCGGCTTCTGCTTTGTCGAGTACTACACCCACCAAGATGCGCTGGATTGC
ATGAAGTATATTGGCGGCACCAAGCTCGACGAGCGCGTCATTCGCACCGACCTGGACCCGGGCTTCGAGGAGGGA
AGACAGTACGGGCGCGGCAAATCGGGCGGCCAGGTTAGAGATGAGTATCGCGAGGATTACGACGAAGGACGCGGT
GGCGTTGGTAGGGCTATCAATGCCGAGCGTCTGCGAGACTACGACGAACAAGGACGCTACGCAGCACGGTGA
Gene >OphauG2|5375
ATGCCGCCTGTCATCAGAAGCACCGTCGACCGCCTCGATAGACCAAGCGCTTACTTCAACAACAGGGTGCACCTC
TACAAAAGCCCACTCCTGCTCCAAGTACTGAGCGCTCATCCTTTTCTGACAGAACAAGCGGAGACGCCGTGACGA
TGACGACGCAGCTGATGAACAGCTTGAACCCTCGGTCGACCCTCTTGCCAATGCCACAACTCTCTATGTCGGCAA
TCTGTATGCGCTTGCCATTGACTTGCATGCTCCTGTAAACTTGCTGACCTCGCTCTCCAGCTCTTTCTACACGAC
TGAGGAGCAAGTATACGAACTCTTCTCCAAATGCGGCGAGATTAAGCGACTGGTAATGGGCCTGGACCGATTCCA
AAAAACTCCCTGCGGCTTCTGCTTTGTCGAGTACTACACCCACCAAGATGCGCTGGATTGCATGAAGTATATTGG
CGGCACCAAGCTCGACGAGCGCGTCATTCGCACCGACCTGGACCCGGGCTTCGAGGAGGGAAGACAGTACGGGCG
CGGCAAATCGGGCGGCCAGGTTAGAGATGAGTATCGCGAGGATTACGACGAAGGACGCGGTGGCGTTGGTAGGGC
TATCAATGCCGAGCGTCTGCGAGACTACGACGAACAAGGACGCTACGCAGCACGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail