Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5368
Gene name
LocationContig_490:8977..10020
Strand+
Gene length (bp)1043
Transcript length (bp)810
Coding sequence length (bp)810
Protein length (aa) 270

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04900 Fcf1 Fcf1 3.5E-27 17 117

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74862|UTP23_SCHPO rRNA-processing protein utp23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp23 PE=3 SV=1 1 220 3.0E-37
sp|Q12339|UTP23_YEAST rRNA-processing protein UTP23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP23 PE=1 SV=1 4 207 1.0E-31
sp|Q9CX11|UTP23_MOUSE rRNA-processing protein UTP23 homolog OS=Mus musculus GN=Utp23 PE=2 SV=1 4 136 5.0E-08

GO

GO Term Description Terminal node
GO:0032040 small-subunit processome Yes
GO:0030684 preribosome No
GO:0032991 protein-containing complex No
GO:1990904 ribonucleoprotein complex No
GO:0005575 cellular_component No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2778
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5368 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3002
Ophiocordyceps camponoti-floridani Ophcf2|00249
Ophiocordyceps camponoti-rufipedis Ophun1|2931
Ophiocordyceps kimflemingae Ophio5|4683
Ophiocordyceps subramaniannii Hirsu2|443

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5368
MEQFSMTFGFREPYQVLVITQCEIRKLYARKSEVGMSEAIEVAKSYERRRCGHHPDEFPQPLSTIECLKAVVDSK
STGENKHRYVVASQNQQVRRMLRSIRGVPLIYIKRSVMILEPMSDKSAETRAREERGKFRSEIKTSLGKRKRIDK
EADDGRGERGGFEDNDGEDDGGLCTSDKPKLQTFGANGAERAKKARQRGPKEPNPLSVRKPKHTQAEATLADARR
RDTPMPNADSSAAADIAPKRKRRRKNKAAVEASRHEMQASADDE*
Coding >OphauG2|5368
ATGGAGCAATTCTCCATGACTTTTGGATTCCGAGAACCCTACCAAGTTTTGGTGATTACGCAGTGCGAGATACGA
AAACTCTACGCGCGAAAGAGTGAGGTGGGCATGAGCGAGGCGATTGAAGTGGCCAAATCTTACGAGCGACGACGG
TGTGGTCATCATCCTGACGAGTTTCCTCAGCCGCTCAGCACAATAGAATGTTTAAAGGCAGTCGTGGACTCGAAA
TCTACGGGCGAAAACAAACACCGCTATGTGGTGGCAAGCCAGAATCAGCAGGTCAGGCGGATGCTGCGAAGCATT
CGAGGCGTGCCCTTGATATATATCAAGCGCAGCGTCATGATACTGGAACCCATGTCAGATAAAAGTGCCGAGACA
CGCGCTCGCGAGGAGCGAGGCAAGTTTCGGTCCGAGATCAAGACGAGTCTCGGAAAAAGGAAGCGAATAGACAAG
GAAGCAGATGATGGGCGAGGCGAGAGGGGGGGTTTTGAGGACAATGACGGGGAAGATGATGGTGGGTTGTGCACC
AGCGACAAACCCAAACTGCAGACTTTTGGAGCCAACGGGGCGGAAAGGGCAAAGAAAGCAAGGCAAAGAGGGCCA
AAAGAACCTAATCCGCTGTCGGTTCGGAAACCCAAGCATACGCAAGCGGAGGCAACATTGGCAGATGCAAGGCGA
AGAGACACACCAATGCCAAACGCAGATTCAAGTGCTGCTGCAGATATTGCGCCCAAGAGGAAGCGGCGAAGAAAA
AACAAAGCGGCTGTGGAGGCCTCGAGGCACGAGATGCAGGCGAGTGCCGATGATGAATGA
Transcript >OphauG2|5368
ATGGAGCAATTCTCCATGACTTTTGGATTCCGAGAACCCTACCAAGTTTTGGTGATTACGCAGTGCGAGATACGA
AAACTCTACGCGCGAAAGAGTGAGGTGGGCATGAGCGAGGCGATTGAAGTGGCCAAATCTTACGAGCGACGACGG
TGTGGTCATCATCCTGACGAGTTTCCTCAGCCGCTCAGCACAATAGAATGTTTAAAGGCAGTCGTGGACTCGAAA
TCTACGGGCGAAAACAAACACCGCTATGTGGTGGCAAGCCAGAATCAGCAGGTCAGGCGGATGCTGCGAAGCATT
CGAGGCGTGCCCTTGATATATATCAAGCGCAGCGTCATGATACTGGAACCCATGTCAGATAAAAGTGCCGAGACA
CGCGCTCGCGAGGAGCGAGGCAAGTTTCGGTCCGAGATCAAGACGAGTCTCGGAAAAAGGAAGCGAATAGACAAG
GAAGCAGATGATGGGCGAGGCGAGAGGGGGGGTTTTGAGGACAATGACGGGGAAGATGATGGTGGGTTGTGCACC
AGCGACAAACCCAAACTGCAGACTTTTGGAGCCAACGGGGCGGAAAGGGCAAAGAAAGCAAGGCAAAGAGGGCCA
AAAGAACCTAATCCGCTGTCGGTTCGGAAACCCAAGCATACGCAAGCGGAGGCAACATTGGCAGATGCAAGGCGA
AGAGACACACCAATGCCAAACGCAGATTCAAGTGCTGCTGCAGATATTGCGCCCAAGAGGAAGCGGCGAAGAAAA
AACAAAGCGGCTGTGGAGGCCTCGAGGCACGAGATGCAGGCGAGTGCCGATGATGAATGA
Gene >OphauG2|5368
ATGGAGCAATTCTCCATGACTTTTGGATTCCGAGAACCCTACCAAGTTTTGGGTGAGTTGAATGCAGACTTGACG
ACGCGCTGCGTGTGCTGATTACATCACGTCAAGTCGATGCTGAAATGATAGTGGACTCGTGCCGATTTAAAATGG
AATTGGCACCGGCCTTGCAACGAACTATCCATGGGAAGGCCAAGCCTCGTGCGTCTCTCGTGCCGCTGTGAAATC
ACAAGGCATATCTCTTTGGCTTTTTAGGCCGACGATTTTTCAGCTGACGGGATTGTGCAGTGATTACGCAGTGCG
AGATACGAAAACTCTACGCGCGAAAGAGTGAGGTGGGCATGAGCGAGGCGATTGAAGTGGCCAAATCTTACGAGC
GACGACGGTGTGGTCATCATCCTGACGAGTTTCCTCAGCCGCTCAGCACAATAGAATGTTTAAAGGCAGTCGTGG
ACTCGAAATCTACGGGCGAAAACAAACACCGCTATGTGGTGGCAAGCCAGAATCAGCAGGTCAGGCGGATGCTGC
GAAGCATTCGAGGCGTGCCCTTGATATATATCAAGCGCAGCGTCATGATACTGGAACCCATGTCAGATAAAAGTG
CCGAGACACGCGCTCGCGAGGAGCGAGGCAAGTTTCGGTCCGAGATCAAGACGAGTCTCGGAAAAAGGAAGCGAA
TAGACAAGGAAGCAGATGATGGGCGAGGCGAGAGGGGGGGTTTTGAGGACAATGACGGGGAAGATGATGGTGGGT
TGTGCACCAGCGACAAACCCAAACTGCAGACTTTTGGAGCCAACGGGGCGGAAAGGGCAAAGAAAGCAAGGCAAA
GAGGGCCAAAAGAACCTAATCCGCTGTCGGTTCGGAAACCCAAGCATACGCAAGCGGAGGCAACATTGGCAGATG
CAAGGCGAAGAGACACACCAATGCCAAACGCAGATTCAAGTGCTGCTGCAGATATTGCGCCCAAGAGGAAGCGGC
GAAGAAAAAACAAAGCGGCTGTGGAGGCCTCGAGGCACGAGATGCAGGCGAGTGCCGATGATGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail