Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|5352
Gene name
LocationContig_49:6687..8213
Strand-
Gene length (bp)1526
Transcript length (bp)1452
Coding sequence length (bp)1452
Protein length (aa) 484

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15460 SAS4 Something about silencing, SAS, complex subunit 4 9.7E-31 220 315

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016573 histone acetylation Yes
GO:0016570 histone modification No
GO:0018193 peptidyl-amino acid modification No
GO:0019538 protein metabolic process No
GO:0018394 peptidyl-lysine acetylation No
GO:0044238 primary metabolic process No
GO:0006475 internal protein amino acid acetylation No
GO:0018205 peptidyl-lysine modification No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0043543 protein acylation No
GO:0018393 internal peptidyl-lysine acetylation No
GO:0043412 macromolecule modification No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0036211 protein modification process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006473 protein acetylation No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6450
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5352 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7838
Ophiocordyceps camponoti-floridani Ophcf2|01015
Ophiocordyceps camponoti-rufipedis Ophun1|2314
Ophiocordyceps kimflemingae Ophio5|6021

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|5352
MASSVTRSSRRAEGAHNQQQQQQQQSCDDEAPDGGSHGRHKRMLDATERDLRPKKTRIAVDVLKPRVAPRLPDAE
LDASLGKHQTKVINDIRHELDRLQQSPMQSPTNPAADTKEQGRKLRSQEATRFKSELSLYFADYDEVIGNDPKEQ
HLLNTDTPIVIVDTKPQCVASVSSQNQPPTSTVSTAIRGYGDSLFTDVFDAQRVDFGFLETQHSSLSVDDPLPDS
MFEATHRRAERLERSIRNTEKGRAQHEKDQIIRLLHGLQGHDWLRVMGVSGITETKKKTFEPARAHFIRGCQNIL
DKFRNWSHQEKRRKQERDKTLAERASEDDKTQAANDGIQDKRQATEGSITGGAGRPESEEAVPAHREHDKSETPS
PAKQLRQEAMARSRLAGKRHRISARSLKISTPPPPAPEREFRSFFSKRYERDNALNRHRRTGRKILAWGLGVPDF
AEADFDLPEEYRDEETLRLRERRKRRDKRSKRQ*
Coding >OphauG2|5352
ATGGCCTCTTCTGTCACCCGCTCCTCCCGGCGAGCTGAAGGAGCGCATAACCAGCAGCAGCAGCAGCAGCAGCAG
AGTTGCGACGATGAGGCGCCCGACGGTGGCAGCCACGGACGGCACAAGAGGATGCTTGACGCGACGGAGCGCGAC
TTGAGGCCCAAGAAGACGCGCATTGCTGTCGATGTTTTGAAACCTCGAGTTGCGCCTCGGCTGCCAGACGCAGAG
CTCGATGCCAGCCTTGGCAAGCACCAGACCAAAGTAATTAATGACATCCGGCACGAGCTGGACCGGCTGCAGCAA
TCACCGATGCAGTCGCCGACTAATCCTGCCGCCGACACCAAGGAACAGGGCCGCAAGCTGCGCTCTCAAGAGGCG
ACTCGGTTCAAGAGCGAGCTGTCTCTATATTTTGCCGACTACGACGAGGTCATTGGCAACGACCCCAAAGAACAG
CATTTGCTAAATACCGATACGCCCATTGTCATTGTTGACACGAAGCCGCAATGCGTTGCTTCTGTCTCTTCCCAA
AACCAGCCCCCCACTTCTACCGTAAGCACTGCCATTCGAGGATACGGAGACTCGCTCTTCACCGACGTCTTTGAT
GCACAGCGAGTCGACTTTGGCTTCCTCGAGACGCAGCACAGCAGCCTAAGCGTTGATGATCCTCTGCCCGACAGT
ATGTTTGAAGCTACACATAGACGAGCCGAACGGCTTGAACGATCTATCCGTAATACGGAAAAGGGGCGAGCTCAG
CACGAAAAGGACCAAATTATACGTCTTCTCCATGGTTTGCAGGGACACGACTGGCTACGAGTCATGGGCGTGAGC
GGTATAACAGAGACCAAGAAGAAGACTTTTGAGCCGGCGCGAGCCCACTTCATCAGGGGATGCCAGAATATCCTG
GACAAATTTCGAAATTGGAGCCATCAGGAAAAACGACGCAAGCAAGAGCGAGATAAAACACTTGCAGAACGCGCT
TCTGAGGATGACAAGACTCAAGCGGCCAATGACGGCATCCAAGACAAGCGACAAGCAACCGAAGGGTCTATTACC
GGTGGAGCCGGGCGCCCCGAATCAGAAGAAGCGGTGCCTGCGCATCGCGAACATGACAAGAGCGAGACACCCTCT
CCGGCCAAGCAGCTTCGTCAAGAAGCCATGGCCCGATCACGCCTGGCGGGTAAGAGGCATCGGATTTCAGCAAGA
TCGCTCAAAATTTCCACGCCACCACCCCCTGCTCCCGAGAGGGAGTTTCGATCATTTTTCAGCAAGAGGTACGAG
CGCGACAATGCGCTGAATCGGCACCGGCGAACAGGGAGAAAAATACTTGCCTGGGGTCTAGGAGTGCCTGACTTT
GCCGAGGCTGATTTTGACTTGCCGGAGGAATATCGCGACGAGGAGACGCTAAGGCTGCGGGAGCGCAGAAAACGG
AGAGACAAACGGAGCAAGCGGCAGTGA
Transcript >OphauG2|5352
ATGGCCTCTTCTGTCACCCGCTCCTCCCGGCGAGCTGAAGGAGCGCATAACCAGCAGCAGCAGCAGCAGCAGCAG
AGTTGCGACGATGAGGCGCCCGACGGTGGCAGCCACGGACGGCACAAGAGGATGCTTGACGCGACGGAGCGCGAC
TTGAGGCCCAAGAAGACGCGCATTGCTGTCGATGTTTTGAAACCTCGAGTTGCGCCTCGGCTGCCAGACGCAGAG
CTCGATGCCAGCCTTGGCAAGCACCAGACCAAAGTAATTAATGACATCCGGCACGAGCTGGACCGGCTGCAGCAA
TCACCGATGCAGTCGCCGACTAATCCTGCCGCCGACACCAAGGAACAGGGCCGCAAGCTGCGCTCTCAAGAGGCG
ACTCGGTTCAAGAGCGAGCTGTCTCTATATTTTGCCGACTACGACGAGGTCATTGGCAACGACCCCAAAGAACAG
CATTTGCTAAATACCGATACGCCCATTGTCATTGTTGACACGAAGCCGCAATGCGTTGCTTCTGTCTCTTCCCAA
AACCAGCCCCCCACTTCTACCGTAAGCACTGCCATTCGAGGATACGGAGACTCGCTCTTCACCGACGTCTTTGAT
GCACAGCGAGTCGACTTTGGCTTCCTCGAGACGCAGCACAGCAGCCTAAGCGTTGATGATCCTCTGCCCGACAGT
ATGTTTGAAGCTACACATAGACGAGCCGAACGGCTTGAACGATCTATCCGTAATACGGAAAAGGGGCGAGCTCAG
CACGAAAAGGACCAAATTATACGTCTTCTCCATGGTTTGCAGGGACACGACTGGCTACGAGTCATGGGCGTGAGC
GGTATAACAGAGACCAAGAAGAAGACTTTTGAGCCGGCGCGAGCCCACTTCATCAGGGGATGCCAGAATATCCTG
GACAAATTTCGAAATTGGAGCCATCAGGAAAAACGACGCAAGCAAGAGCGAGATAAAACACTTGCAGAACGCGCT
TCTGAGGATGACAAGACTCAAGCGGCCAATGACGGCATCCAAGACAAGCGACAAGCAACCGAAGGGTCTATTACC
GGTGGAGCCGGGCGCCCCGAATCAGAAGAAGCGGTGCCTGCGCATCGCGAACATGACAAGAGCGAGACACCCTCT
CCGGCCAAGCAGCTTCGTCAAGAAGCCATGGCCCGATCACGCCTGGCGGGTAAGAGGCATCGGATTTCAGCAAGA
TCGCTCAAAATTTCCACGCCACCACCCCCTGCTCCCGAGAGGGAGTTTCGATCATTTTTCAGCAAGAGGTACGAG
CGCGACAATGCGCTGAATCGGCACCGGCGAACAGGGAGAAAAATACTTGCCTGGGGTCTAGGAGTGCCTGACTTT
GCCGAGGCTGATTTTGACTTGCCGGAGGAATATCGCGACGAGGAGACGCTAAGGCTGCGGGAGCGCAGAAAACGG
AGAGACAAACGGAGCAAGCGGCAGTGA
Gene >OphauG2|5352
ATGGCCTCTTCTGTCACCCGCTCCTCCCGGCGAGCTGAAGGAGCGCATAACCAGCAGCAGCAGCAGCAGCAGCAG
AGTTGCGACGATGAGGCGCCCGACGGTGGCAGCCACGGACGGCACAAGAGGATGCTTGACGCGACGGAGCGCGAC
TTGAGGCCCAAGAAGACGCGCATTGCTGTCGATGTTTTGAAACCTCGAGTTGCGCCTCGGCTGCCAGACGCAGAG
CTCGATGCCAGCCTTGGCAAGCACCAGACCAAAGTAATTAATGACATCCGGCACGAGCTGGACCGGCTGCAGCAA
TCACCGATGCAGTCGCCGACTAATCCTGCCGCCGACACCAAGGAACAGGGCCGCAAGCTGCGCTCTCAAGAGGCG
ACTCGGTTCAAGAGCGAGCTGTCTCTATATTTTGCCGACTACGACGAGGTCATTGGCAACGACCCCAAAGAACAG
CGTGCGTCTTGTTGCGCGTTTTGATGCATCTGCTTTGCACACACCCATATTGACTAATGCGCCCAATGCTTCTAG
ATTTGCTAAATACCGATACGCCCATTGTCATTGTTGACACGAAGCCGCAATGCGTTGCTTCTGTCTCTTCCCAAA
ACCAGCCCCCCACTTCTACCGTAAGCACTGCCATTCGAGGATACGGAGACTCGCTCTTCACCGACGTCTTTGATG
CACAGCGAGTCGACTTTGGCTTCCTCGAGACGCAGCACAGCAGCCTAAGCGTTGATGATCCTCTGCCCGACAGTA
TGTTTGAAGCTACACATAGACGAGCCGAACGGCTTGAACGATCTATCCGTAATACGGAAAAGGGGCGAGCTCAGC
ACGAAAAGGACCAAATTATACGTCTTCTCCATGGTTTGCAGGGACACGACTGGCTACGAGTCATGGGCGTGAGCG
GTATAACAGAGACCAAGAAGAAGACTTTTGAGCCGGCGCGAGCCCACTTCATCAGGGGATGCCAGAATATCCTGG
ACAAATTTCGAAATTGGAGCCATCAGGAAAAACGACGCAAGCAAGAGCGAGATAAAACACTTGCAGAACGCGCTT
CTGAGGATGACAAGACTCAAGCGGCCAATGACGGCATCCAAGACAAGCGACAAGCAACCGAAGGGTCTATTACCG
GTGGAGCCGGGCGCCCCGAATCAGAAGAAGCGGTGCCTGCGCATCGCGAACATGACAAGAGCGAGACACCCTCTC
CGGCCAAGCAGCTTCGTCAAGAAGCCATGGCCCGATCACGCCTGGCGGGTAAGAGGCATCGGATTTCAGCAAGAT
CGCTCAAAATTTCCACGCCACCACCCCCTGCTCCCGAGAGGGAGTTTCGATCATTTTTCAGCAAGAGGTACGAGC
GCGACAATGCGCTGAATCGGCACCGGCGAACAGGGAGAAAAATACTTGCCTGGGGTCTAGGAGTGCCTGACTTTG
CCGAGGCTGATTTTGACTTGCCGGAGGAATATCGCGACGAGGAGACGCTAAGGCTGCGGGAGCGCAGAAAACGGA
GAGACAAACGGAGCAAGCGGCAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail